4DO8: Muscarinic toxin MT1

Name: PDB 4DO8: Crystal structure of the muscarinic toxin MT1
Published: 2012-06-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Crystal structure of the muscarinic toxin MT1. Determined by X-ray diffraction at 1.8 Å resolution. Released 27 Jun 2012.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Dendroaspis angusticeps
Chains: 2
Atoms: 1,203
Mol. weight: 15.17 kDa
Ligands: SCN
Released: 27 Jun 2012

Explore 4DO8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DO8 contains 4 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	11-16	6	1
α-helix	17-18	2
β-strand	23-32	10	2
β-strand	35-43	9	2
α-helix	46-49	4
β-strand	54-59	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Muscarinic toxin 1	A, B	protein	66	Dendroaspis angusticeps	P81030 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4DO8_1 Muscarinic toxin 1 (chains A, B)
LTCVTSKSIFGITTENCPDGQNLCFKKWYYIVPRYSDITWGCAATCPKPTNVRETIRCCE
TDKCNE

Ligands and cofactors

ID	Name	Formula	Copies
SCN	Thiocyanate ion	C N S	1

Water and common crystallization additives (ACT) are not listed.

Primary citation

Engineering of three-finger fold toxins creates ligands with original pharmacological profiles for muscarinic and adrenergic receptors. Fruchart-Gaillard, C., Mourier, G., Blanchet, G. et al. PLoS One (2012) 7:e39166-e39166. DOI 10.1371/journal.pone.0039166 · PubMed

Other PDB entries of the same protein (UniProt P81030 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NEQ 1.25 Å, Crystal structure of the chimeric muscarinic toxin MT7 with loop 3 from MT1
3FEV 1.3 Å, Crystal structure of the chimeric muscarinic toxin MT7 with loop 1 from MT1.

Browse structure collections

About this viewer

MolViewer shows 4DO8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.