Crystal structure of the ATP-gated P2X4 ion channel in the closed, apo state at 2.9 Angstroms. Determined by X-ray diffraction at 2.9 Å resolution. Released 25 Apr 2012.
Explore 4DW0 in 3D Show helices and sheets RCSB PDB PDBe
4DW0 contains 12 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 35-43 | 9 | |
| α-helix | 44-53 | 10 | |
| β-strand | 58-62 | 5 | 1 |
| β-strand | 64-72 | 9 | 2 |
| β-strand | 75-79 | 5 | 3 |
| β-strand | 83-87 | 5 | 3 |
| α-helix | 89-92 | 4 | |
| β-strand | 93 | 1 | 1 |
| β-strand | 98 | 1 | 1 |
| β-strand | 101-114 | 14 | 1 |
| β-strand | 115-120 | 6 | 4 |
| α-helix | 121-123 | 3 | |
| β-strand | 128 | 1 | 4 |
| β-strand | 147-153 | 7 | 4 |
| β-strand | 161-168 | 8 | 4 |
| α-helix | 170-172 | 3 | |
| α-helix | 175-177 | 3 | |
| α-helix | 183-187 | 5 | |
| β-strand | 189-198 | 10 | 2 |
| β-strand | 203-206 | 4 | 2 |
| α-helix | 214-219 | 6 | |
| β-strand | 232-234 | 3 | 2 |
| α-helix | 235-241 | 7 | |
| α-helix | 246-249 | 4 | |
| β-strand | 254-265 | 12 | 1 |
| α-helix | 270-272 | 3 | |
| β-strand | 275-281 | 7 | 1 |
| β-strand | 296-305 | 10 | 1 |
| β-strand | 309-333 | 25 | 1 |
| α-helix | 335-357 | 23 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| P2X purinoceptor | A | protein | 340 | Danio rerio | F8W463 (AlphaFold model) |
>4DW0_1 P2X purinoceptor (chains A) GSSKKVGTLNRFTQALVIAYVIGYVFVYNKGYQDTDTVLSSVTTKVKGIALTKTSELGER IWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGD GVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAERFTVLIKNNIRYPKFNFNK RNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCD LDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVM VFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWIVLTFMK
Water and common crystallization additives (GOL) are not listed.
Molecular mechanism of ATP binding and ion channel activation in P2X receptors. Hattori, M., Gouaux, E. Nature (2012) 485:207-212. DOI 10.1038/nature11010 · PubMed
Other PDB entries of the same protein (UniProt F8W463 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4DW0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.