4DX9: ICAP1

ICAP1 in complex with integrin beta 1 cytoplasmic tail. Determined by X-ray diffraction at 2.99 Å resolution. Released 9 Jan 2013.

Method: X-ray diffraction
Resolution: 2.99 Å
Organism: Homo sapiens
Chains: 62
Atoms: 29,306
Mol. weight: 601.36 kDa
Released: 9 Jan 2013

Explore 4DX9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DX9 contains 66 α-helices and 271 β-strands across 57 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 0: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	62-70	9	4
α-helix	89-98	10
β-strand	109-114	6	4
β-strand	118-122	5	4
β-strand	131-134	4	4
β-strand	140-144	5	4
β-strand	145	1	5
β-strand	153	1	5
β-strand	155-158	4	4
β-strand	169-174	6	4
α-helix	178-194	17

Chain 1: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	61-65	5	16
β-strand	66-70	5	17
α-helix	85-98	14
β-strand	110-114	5	16
β-strand	119-122	4	16
β-strand	131-132	2	16
β-strand	141-145	5	17
β-strand	153-159	7	17
β-strand	168-174	7	17
α-helix	177-192	16

Chain 2: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	61-63	3	23
β-strand	66-67	2	24
α-helix	85-95	11
β-strand	112-114	3	23
β-strand	118	1	25
β-strand	134	1	25
β-strand	138	1	26
β-strand	143-144	2	24
β-strand	153-158	6	24
β-strand	159	1	26
β-strand	169-174	6	24
α-helix	177-192	16

Chain 3: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	61-65	5	23
β-strand	66-71	6	30
α-helix	87-98	12
α-helix	108-109	2
β-strand	110-114	5	23
β-strand	118-122	5	23
β-strand	131-134	4	23
β-strand	141-145	5	30
β-strand	153-159	7	30
β-strand	168-174	7	30
α-helix	177-187	11

Chain 4: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	61-65	5	40
β-strand	66-71	6	41
α-helix	85-94	10
β-strand	110-114	5	40
β-strand	118-123	6	40
β-strand	129-134	6	40
β-strand	138	1	42
β-strand	142-145	4	41
β-strand	153-158	6	41
β-strand	159	1	42
β-strand	169-174	6	41
α-helix	177-193	17

Chain 5: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	61-65	5	10
β-strand	66-71	6	11
α-helix	89-95	7
β-strand	110-115	6	10
β-strand	118-123	6	10
β-strand	129-134	6	10
β-strand	138-142	5	11
β-strand	143	1	12
β-strand	153-154	2	11
β-strand	156-160	5	11
β-strand	167-174	8	11
α-helix	177-194	18

Chain 6: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	785-787	3	4
β-strand	788	1	12

Chain 7: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	788-789	2	41

33 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin beta-1-binding protein 1	0, 1, 2, 3, 4, 5, A, C, E, G, I, K, M, O, Q, S, U, W, Y, a, c, e, g, i, k, m, o, q, s, u, w, y	protein	157	Homo sapiens	O14713 (AlphaFold model)
Integrin beta-1	6, 7, 8, 9, B, D, F, H, J, L, N, P, R, T, V, X, Z, b, d, f, h, j, l, n, p, r, t, v, x, z	protein	15	Homo sapiens	P05556 (AlphaFold model)

Sequence of entity 1 (0, 1, 2, 3, 4, 5, A, C, E, G, I, K, M, O, Q, S, U, W, Y, a, c, e, g, i, k, m, o, q, s, u, w, y), FASTA

>4DX9_1 Integrin beta-1-binding protein 1 (chains 0, 1, 2, 3, 4, 5, A, C, E, G, I, K, M, O, Q, S, U, W, Y, a, c, e, g, i, k, m, o, q, s, u, w, y)
GPLGSSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPF
VPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDAS
NEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP

Sequence of entity 2 (6, 7, 8, 9, B, D, F, H, J, L, N, P, R, T, V, X, Z, b, d, f, h, j, l, n, p, r, t, v, x, z), FASTA

>4DX9_2 Integrin beta-1 (chains 6, 7, 8, 9, B, D, F, H, J, L, N, P, R, T, V, X, Z, b, d, f, h, j, l, n, p, r, t, v, x, z)
KSAVTTVVNPKYEGK

Primary citation

Mechanism for KRIT1 Release of ICAP1-Mediated Suppression of Integrin Activation. Liu, W., Draheim, K.M., Zhang, R. et al. Mol Cell (2013) 49:719-729. DOI 10.1016/j.molcel.2012.12.005 · PubMed

Other PDB entries of the same protein (UniProt O14713 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JIF 1.7 Å, Co-crystal structure of ICAP1 PTB domain in complex with a KRIT1 peptide
4DX8 2.54 Å, ICAP1 in complex with KRIT1 N-terminus

Browse structure collections

About this viewer

MolViewer shows 4DX9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.