4JIF: Co-crystal structure of ICAP1 PTB domain

Co-crystal structure of ICAP1 PTB domain in complex with a KRIT1 peptide. Determined by X-ray diffraction at 1.7 Å resolution. Released 1 May 2013.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,327
Mol. weight: 20.64 kDa
Released: 1 May 2013

Explore 4JIF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JIF contains 6 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	61-74	14	1
α-helix	85-97	13
β-strand	109-115	7	1
β-strand	118-123	6	1
β-strand	129-134	6	1
α-helix	135-137	3
β-strand	138-145	8	1
β-strand	153-160	8	1
β-strand	167-174	8	1
α-helix	177-192	16

Chain B: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	179-181	3
α-helix	182-185	4
β-strand	186-191	6	1
α-helix	193-195	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin beta-1-binding protein 1	A	protein	154	Homo sapiens	O14713 (AlphaFold model)
Krev interaction trapped protein 1	B	protein	34	Homo sapiens	O00522 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4JIF_1 Integrin beta-1-binding protein 1 (chains A)
GSSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPP
EEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEE
YSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP

Sequence of entity 2 (B), FASTA

>4JIF_2 Krev interaction trapped protein 1 (chains B)
GPLGSQSHFIPALFRPSPLERIKTNVINPAYATE

Primary citation

Cocrystal structure of the ICAP1 PTB domain in complex with a KRIT1 peptide. Liu, W., Boggon, T.J. Acta Crystallogr Sect F Struct Biol Cryst Commun (2013) 69:494-498. DOI 10.1107/S1744309113010762 · PubMed

Other PDB entries of the same protein (UniProt O14713 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DX8 2.54 Å, ICAP1 in complex with KRIT1 N-terminus
4DX9 2.99 Å, ICAP1 in complex with integrin beta 1 cytoplasmic tail

Browse structure collections

About this viewer

MolViewer shows 4JIF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.