4DX9: ICAP1
ICAP1 in complex with integrin beta 1 cytoplasmic tail. Determined by X-ray diffraction at 2.99 Å resolution. Released 9 Jan 2013.
- Method
- X-ray diffraction
- Resolution
- 2.99 Å
- Organism
- Homo sapiens
- Chains
- 62
- Atoms
- 29,306
- Mol. weight
- 601.36 kDa
- Released
- 9 Jan 2013
Explore 4DX9 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4DX9 contains 66 α-helices and 271 β-strands across 57 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain 0: 2 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 62-70 | 9 | 4 |
| α-helix | 89-98 | 10 | |
| β-strand | 109-114 | 6 | 4 |
| β-strand | 118-122 | 5 | 4 |
| β-strand | 131-134 | 4 | 4 |
| β-strand | 140-144 | 5 | 4 |
| β-strand | 145 | 1 | 5 |
| β-strand | 153 | 1 | 5 |
| β-strand | 155-158 | 4 | 4 |
| β-strand | 169-174 | 6 | 4 |
| α-helix | 178-194 | 17 | |
Chain 1: 2 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 61-65 | 5 | 16 |
| β-strand | 66-70 | 5 | 17 |
| α-helix | 85-98 | 14 | |
| β-strand | 110-114 | 5 | 16 |
| β-strand | 119-122 | 4 | 16 |
| β-strand | 131-132 | 2 | 16 |
| β-strand | 141-145 | 5 | 17 |
| β-strand | 153-159 | 7 | 17 |
| β-strand | 168-174 | 7 | 17 |
| α-helix | 177-192 | 16 | |
Chain 2: 2 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 61-63 | 3 | 23 |
| β-strand | 66-67 | 2 | 24 |
| α-helix | 85-95 | 11 | |
| β-strand | 112-114 | 3 | 23 |
| β-strand | 118 | 1 | 25 |
| β-strand | 134 | 1 | 25 |
| β-strand | 138 | 1 | 26 |
| β-strand | 143-144 | 2 | 24 |
| β-strand | 153-158 | 6 | 24 |
| β-strand | 159 | 1 | 26 |
| β-strand | 169-174 | 6 | 24 |
| α-helix | 177-192 | 16 | |
Chain 3: 3 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 61-65 | 5 | 23 |
| β-strand | 66-71 | 6 | 30 |
| α-helix | 87-98 | 12 | |
| α-helix | 108-109 | 2 | |
| β-strand | 110-114 | 5 | 23 |
| β-strand | 118-122 | 5 | 23 |
| β-strand | 131-134 | 4 | 23 |
| β-strand | 141-145 | 5 | 30 |
| β-strand | 153-159 | 7 | 30 |
| β-strand | 168-174 | 7 | 30 |
| α-helix | 177-187 | 11 | |
Chain 4: 2 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 61-65 | 5 | 40 |
| β-strand | 66-71 | 6 | 41 |
| α-helix | 85-94 | 10 | |
| β-strand | 110-114 | 5 | 40 |
| β-strand | 118-123 | 6 | 40 |
| β-strand | 129-134 | 6 | 40 |
| β-strand | 138 | 1 | 42 |
| β-strand | 142-145 | 4 | 41 |
| β-strand | 153-158 | 6 | 41 |
| β-strand | 159 | 1 | 42 |
| β-strand | 169-174 | 6 | 41 |
| α-helix | 177-193 | 17 | |
Chain 5: 2 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 61-65 | 5 | 10 |
| β-strand | 66-71 | 6 | 11 |
| α-helix | 89-95 | 7 | |
| β-strand | 110-115 | 6 | 10 |
| β-strand | 118-123 | 6 | 10 |
| β-strand | 129-134 | 6 | 10 |
| β-strand | 138-142 | 5 | 11 |
| β-strand | 143 | 1 | 12 |
| β-strand | 153-154 | 2 | 11 |
| β-strand | 156-160 | 5 | 11 |
| β-strand | 167-174 | 8 | 11 |
| α-helix | 177-194 | 18 | |
Chain 6: 0 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 785-787 | 3 | 4 |
| β-strand | 788 | 1 | 12 |
Chain 7: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 788-789 | 2 | 41 |
33 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Integrin beta-1-binding protein 1 | 0, 1, 2, 3, 4, 5, A, C, E, G, I, K, M, O, Q, S, U, W, Y, a, c, e, g, i, k, m, o, q, s, u, w, y | protein | 157 | Homo sapiens | O14713 (AlphaFold model) |
| Integrin beta-1 | 6, 7, 8, 9, B, D, F, H, J, L, N, P, R, T, V, X, Z, b, d, f, h, j, l, n, p, r, t, v, x, z | protein | 15 | Homo sapiens | P05556 (AlphaFold model) |
Sequence of entity 1 (0, 1, 2, 3, 4, 5, A, C, E, G, I, K, M, O, Q, S, U, W, Y, a, c, e, g, i, k, m, o, q, s, u, w, y), FASTA
>4DX9_1 Integrin beta-1-binding protein 1 (chains 0, 1, 2, 3, 4, 5, A, C, E, G, I, K, M, O, Q, S, U, W, Y, a, c, e, g, i, k, m, o, q, s, u, w, y)
GPLGSSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPF
VPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDAS
NEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP
Sequence of entity 2 (6, 7, 8, 9, B, D, F, H, J, L, N, P, R, T, V, X, Z, b, d, f, h, j, l, n, p, r, t, v, x, z), FASTA
>4DX9_2 Integrin beta-1 (chains 6, 7, 8, 9, B, D, F, H, J, L, N, P, R, T, V, X, Z, b, d, f, h, j, l, n, p, r, t, v, x, z)
KSAVTTVVNPKYEGK
Primary citation
Mechanism for KRIT1 Release of ICAP1-Mediated Suppression of Integrin Activation. Liu, W., Draheim, K.M., Zhang, R. et al. Mol Cell (2013) 49:719-729. DOI 10.1016/j.molcel.2012.12.005 · PubMed
Other PDB entries of the same protein (UniProt O14713 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4JIF 1.7 Å, Co-crystal structure of ICAP1 PTB domain in complex with a KRIT1 peptide
- 4DX8 2.54 Å, ICAP1 in complex with KRIT1 N-terminus
Browse structure collections
About this viewer
MolViewer shows 4DX9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.