Crystal structure of a Peptidyl-prolyl cis-trans isomerase with surface mutation M61H from Burkholderia pseudomallei complexed with FK506. Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Mar 2012.
Explore 4DZ3 in 3D Show helices and sheets RCSB PDB PDBe
4DZ3 contains 9 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-5 | 3 | 1 |
| β-strand | 11-16 | 6 | 1 |
| α-helix | 21 | 1 | |
| β-strand | 22 | 1 | 2 |
| α-helix | 23 | 1 | |
| β-strand | 28-37 | 10 | 1 |
| β-strand | 42-45 | 4 | 1 |
| β-strand | 53-56 | 4 | 1 |
| α-helix | 64-69 | 6 | |
| β-strand | 74 | 1 | 2 |
| β-strand | 78-83 | 6 | 1 |
| α-helix | 85-87 | 3 | |
| β-strand | 94 | 1 | 3 |
| β-strand | 98 | 1 | 3 |
| β-strand | 104-112 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 4 |
| β-strand | 11-16 | 6 | 4 |
| α-helix | 21 | 1 | |
| β-strand | 22 | 1 | 5 |
| α-helix | 23 | 1 | |
| β-strand | 28-37 | 10 | 4 |
| β-strand | 42-45 | 4 | 4 |
| α-helix | 46-49 | 4 | |
| β-strand | 53-56 | 4 | 4 |
| α-helix | 64-69 | 6 | |
| β-strand | 74 | 1 | 5 |
| β-strand | 78-83 | 6 | 4 |
| α-helix | 85-87 | 3 | |
| β-strand | 94 | 1 | 6 |
| β-strand | 98 | 1 | 6 |
| β-strand | 104-112 | 9 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peptidyl-prolyl cis-trans isomerase | A, B | protein | 113 | Burkholderia pseudomallei | Q3JK38 (AlphaFold model) |
>4DZ3_1 Peptidyl-prolyl cis-trans isomerase (chains A, B) STVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGG HVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Water and common crystallization additives (ACT, EDO) are not listed.
A structural biology approach enables the development of antimicrobials targeting bacterial immunophilins. Begley, D.W., Fox, D., Jenner, D. et al. Antimicrob Agents Chemother (2014) 58:1458-1467. DOI 10.1128/AAC.01875-13 · PubMed
Other PDB entries of the same protein (UniProt Q3JK38 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4DZ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.