Crystal structure of a SMT fusion Peptidyl-prolyl cis-trans isomerase with surface mutation D44G from Burkholderia pseudomallei complexed with CJ168. Determined by X-ray diffraction at 1.75 Å resolution. Released 1 Aug 2012.
Explore 4G50 in 3D Show helices and sheets RCSB PDB PDBe
4G50 contains 15 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | -75--69 | 7 | 1 |
| β-strand | -64--58 | 7 | 1 |
| α-helix | -52--43 | 10 | |
| α-helix | -38--36 | 3 | |
| β-strand | -35--31 | 5 | 1 |
| β-strand | -28--27 | 2 | 1 |
| α-helix | -26--25 | 2 | |
| β-strand | -11--5 | 7 | 1 |
| β-strand | 3-5 | 3 | 2 |
| β-strand | 11-16 | 6 | 2 |
| β-strand | 19 | 1 | 3 |
| α-helix | 22-23 | 2 | |
| β-strand | 28-37 | 10 | 2 |
| β-strand | 42-45 | 4 | 2 |
| β-strand | 53-56 | 4 | 2 |
| α-helix | 64-69 | 6 | |
| β-strand | 75 | 1 | 3 |
| β-strand | 78-83 | 6 | 2 |
| α-helix | 85-87 | 3 | |
| β-strand | 94 | 1 | 4 |
| β-strand | 98 | 1 | 4 |
| α-helix | 99 | 1 | |
| β-strand | 104-112 | 9 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | -75--69 | 7 | 5 |
| β-strand | -64--58 | 7 | 5 |
| α-helix | -52--43 | 10 | |
| α-helix | -38--36 | 3 | |
| β-strand | -35--31 | 5 | 5 |
| β-strand | -28--27 | 2 | 5 |
| α-helix | -26--25 | 2 | |
| β-strand | -10--5 | 6 | 5 |
| β-strand | 3-5 | 3 | 6 |
| β-strand | 11-16 | 6 | 6 |
| α-helix | 21 | 1 | |
| β-strand | 22 | 1 | 7 |
| α-helix | 23 | 1 | |
| β-strand | 28-37 | 10 | 6 |
| β-strand | 42-45 | 4 | 6 |
| β-strand | 53-56 | 4 | 6 |
| α-helix | 64-69 | 6 | |
| β-strand | 74 | 1 | 7 |
| β-strand | 78-83 | 6 | 6 |
| α-helix | 85-87 | 3 | |
| β-strand | 94 | 1 | 8 |
| β-strand | 98 | 1 | 8 |
| α-helix | 99 | 1 | |
| β-strand | 104-112 | 9 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin-like protein SMT3, Peptidyl-prolyl cis-trans isomerase | A, B | protein | 209 | Saccharomyces cerevisiae, Burkholderia pseudomallei | Q12306 (AlphaFold model), Q3JK38 (AlphaFold model) |
>4G50_1 Ubiquitin-like protein SMT3, Peptidyl-prolyl cis-trans isomerase (chains A, B) MGHHHHHHSGEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDS LRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGSTVVTTESGLKYEDLTEGSGAEAR AGQTVSVHYTGWLTDGQKFGSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIP PQLGYGARGAGGVIPPNATLVFEVELLDV
| ID | Name | Formula | Copies |
|---|---|---|---|
| 861 | 3-(3,4,5-trimethoxyphenyl)propyl (2S)-1-(benzylsulfonyl)piperidine-2-carboxylate | C25 H33 N O7 S | 2 |
Water and common crystallization additives (FMT, EDO) are not listed.
A structural biology approach enables the development of antimicrobials targeting bacterial immunophilins. Begley, D.W., Fox, D., Jenner, D. et al. Antimicrob Agents Chemother (2014) 58:1458-1467. DOI 10.1128/AAC.01875-13 · PubMed
Other PDB entries of the same protein (UniProt Q12306 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4G50 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.