4DZD: Uncharacterized protein ygcH

Crystal structure of the CRISPR-associated protein Cas6e from Escherichia coli str. K-12. Determined by X-ray diffraction at 2.0 Å resolution. Released 6 Mar 2013.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Escherichia coli
Chains: 1
Atoms: 1,703
Mol. weight: 24.45 kDa
Released: 6 Mar 2013

Explore 4DZD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DZD contains 9 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
α-helix	10-12	3
α-helix	16-24	9
β-strand	37-46	10	1
β-strand	49-56	8	1
β-strand	66-73	8	1
β-strand	83-90	8	2
β-strand	93-97	5	3
β-strand	103	1	4
α-helix	108	1
β-strand	109	1	4
α-helix	110	1
β-strand	111-115	5	3
α-helix	119-130	12
α-helix	131-133	3
β-strand	134-143	10	2
α-helix	144-146	3
β-strand	147-148	2	5
β-strand	157-158	2	5
β-strand	161-169	9	2
α-helix	172-181	10
α-helix	187-189	3
β-strand	194-198	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uncharacterized protein ygcH	A	protein	218	Escherichia coli	Q46897 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4DZD_1 Uncharacterized protein ygcH (chains A)
MGSSHHHHHHSSGLVPRGSMYLSKVIIARAWSRDLYQLHQGLWHLFPNRPDAARDFLFHV
EKRNTPEGCHVLLQSAQMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQK
RLDSKGNIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGKIQTV
CFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL

Primary citation

Crystal Structure of endoribonuclease Cas6e from Escherichia coli. Wei, J., Huang, G., Wang, Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q46897 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5H9F 2.45 Å, Crystal structure of E. coli Cascade bound to a PAM-containing dsDNA target at 2.45…
4U7U 3.0 Å, Crystal structure of RNA-guided immune Cascade complex from E.coli
4QYZ 3.03 Å, Crystal structure of a CRISPR RNA-guided surveillance complex, Cascade, bound to a ssDNA…
5CD4 3.2 Å, The Type IE CRISPR Cascade complex from E. coli, with two assemblies in the asymmetric…
5H9E 3.21 Å, Crystal structure of E. coli Cascade bound to a PAM-containing dsDNA target (32-nt…
4TVX 3.24 Å, Crystal structure of the E. coli CRISPR RNA-guided surveillance complex, Cascade

Browse structure collections

About this viewer

MolViewer shows 4DZD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.