4E0S: C5b-6

Crystal Structure of C5b-6. Determined by X-ray diffraction at 4.21 Å resolution. Released 18 Apr 2012.

Method: X-ray diffraction
Resolution: 4.21 Å
Organism: Homo sapiens
Chains: 2
Atoms: 19,475
Mol. weight: 293.03 kDa
Ligands: MAN, CA
Released: 18 Apr 2012

Explore 4E0S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4E0S contains 79 α-helices and 191 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 34 helices, 124 β-strands

Element	Residues	Length	Sheet
β-strand	23-28	6	1
β-strand	31-32	2	2
β-strand	36-38	3	3
β-strand	40-43	4	1
β-strand	50-57	8	4
β-strand	65-73	9	4
α-helix	75-77	3
β-strand	80-81	2	1
β-strand	84-86	3	3
β-strand	101-108	8	4
β-strand	112-118	7	4
β-strand	119-120	2	2
β-strand	125-130	6	5
β-strand	134-135	2	6
β-strand	140-148	9	5
β-strand	159-164	6	6
β-strand	170-176	7	6
β-strand	182-189	8	5
α-helix	194-196	3
β-strand	197-205	9	6
β-strand	212-219	8	6
β-strand	227-233	7	7
β-strand	237-238	2	8
β-strand	247-254	8	7
β-strand	259	1	7
β-strand	262-272	11	8
β-strand	281-283	3	8
β-strand	288-293	6	8
β-strand	296	1	8
β-strand	297-300	4	7
α-helix	303-307	5
β-strand	321-331	11	8
β-strand	337-347	11	8
β-strand	353-354	2	9
β-strand	362-363	2	10
β-strand	368-374	7	11
β-strand	375-376	2	9
β-strand	382	1	9
β-strand	387-396	10	10
β-strand	401-403	3	10
α-helix	404-406	3
β-strand	407-410	4	10
β-strand	417-423	7	11
β-strand	428-437	10	10
β-strand	449-456	8	10
β-strand	466-468	3	12
β-strand	476	1	13
β-strand	481-487	7	12
β-strand	498-505	8	14
β-strand	508-516	9	14
α-helix	517-518	2
β-strand	524-529	6	12
α-helix	532-534	3
β-strand	537-547	11	14
β-strand	552-562	11	14
β-strand	563	1	13
β-strand	574-575	2	15
β-strand	582	1	16
β-strand	587-593	7	15
β-strand	598-601	4	17
β-strand	604-606	3	16
α-helix	609-611	3
α-helix	621-627	7
α-helix	642-648	7
β-strand	651-655	5	1
α-helix	668-669	2
β-strand	765-766	2	18
β-strand	772-773	2	16
β-strand	777-780	4	17
β-strand	783-789	7	15
β-strand	795-799	5	16
β-strand	802-805	4	17
β-strand	808-811	4	17
α-helix	812-814	3
β-strand	815-819	5	16
β-strand	823-828	6	19
β-strand	833-834	2	20
β-strand	839-841	3	21
β-strand	842-847	6	19
β-strand	853-860	8	18
β-strand	865	1	22
β-strand	886-888	3	18
α-helix	889	1
β-strand	892-895	4	19
β-strand	898-900	3	21
β-strand	902	1	22
β-strand	910-916	7	18
β-strand	919-925	7	18
β-strand	929-930	2	20
β-strand	937-944	8	23
β-strand	945	1	24
β-strand	954	1	24
β-strand	956-959	4	25
β-strand	967	1	26
α-helix	972-973	2
β-strand	974-981	8	23
α-helix	994-1002	9
α-helix	1011-1027	17
α-helix	1031-1034	4
α-helix	1038-1057	20
β-strand	1060	1	27
β-strand	1066	1	27
β-strand	1067	1	28
β-strand	1074	1	28
α-helix	1076-1090	15
α-helix	1097-1110	14
β-strand	1112	1	29
β-strand	1118	1	29
α-helix	1139-1155	17
α-helix	1156-1158	3
α-helix	1162-1177	16
α-helix	1185-1195	11
α-helix	1203-1215	13
β-strand	1217-1219	3	30
β-strand	1225-1227	3	30
α-helix	1246-1261	16
α-helix	1264-1281	18
α-helix	1287-1301	15
α-helix	1303-1307	5
β-strand	1310	1	31
β-strand	1315-1317	3	25
β-strand	1329	1	31
β-strand	1336-1339	4	23
β-strand	1346-1349	4	25
β-strand	1354	1	31
β-strand	1357-1364	8	23
β-strand	1367	1	26
β-strand	1377-1385	9	32
β-strand	1400-1408	9	32
β-strand	1418	1	33
β-strand	1422-1427	6	34
α-helix	1428-1429	2
α-helix	1436-1443	8
β-strand	1452	1	34
β-strand	1455-1456	2	34
β-strand	1459-1464	6	34
β-strand	1468	1	33
β-strand	1473-1479	7	32
β-strand	1491-1497	7	34
β-strand	1500-1509	10	34
β-strand	1517-1521	5	35
β-strand	1524-1528	5	35
α-helix	1531-1533	3
α-helix	1545-1552	8
β-strand	1559-1568	10	36
β-strand	1571	1	37
β-strand	1574	1	37
β-strand	1577-1581	5	36
β-strand	1586	1	36
β-strand	1597-1601	5	36
α-helix	1611-1612	2
β-strand	1616-1621	6	36
β-strand	1625	1	36
β-strand	1628-1629	2	38
β-strand	1632-1633	2	38
β-strand	1636-1638	3	36
β-strand	1644-1646	3	36
α-helix	1657-1673	17

Chain B: 45 helices, 67 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	7	1
β-strand	8	1	39
α-helix	9-14	6
β-strand	21	1	40
β-strand	24-25	2	41
β-strand	27	1	39
α-helix	33-37	5
α-helix	40-43	4
β-strand	48-49	2	41
β-strand	52	1	40
α-helix	56-58	3
β-strand	59	1	42
β-strand	62	1	43
α-helix	68-70	3
β-strand	78-79	2	44
β-strand	82	1	45
β-strand	87	1	43
β-strand	89-90	2	42
α-helix	94-96	3
β-strand	101	1	45
β-strand	104-105	2	44
α-helix	119-121	3
α-helix	133-135	3
α-helix	147-149	3
β-strand	164-165	2	46
α-helix	166	1
α-helix	169-172	4
β-strand	174-177	4	47
β-strand	182-186	5	47
β-strand	188	1	48
β-strand	199-200	2	46
α-helix	201-202	2
α-helix	208	1
β-strand	209-210	2	46
β-strand	215-219	5	49
α-helix	226-228	3
β-strand	229-234	6	49
α-helix	239-244	6
β-strand	265	1	49
α-helix	275-285	11
β-strand	290-306	17	49
β-strand	313	1	48
α-helix	315-320	6
α-helix	330-340	11
β-strand	343	1	47
β-strand	347-361	15	49
α-helix	362-368	7
α-helix	372-386	15
α-helix	393-395	3
α-helix	405-408	4
α-helix	413-415	3
β-strand	418-421	4	49
β-strand	424	1	49
α-helix	428-434	7
α-helix	445-457	13
β-strand	460-465	6	49
β-strand	468	1	47
α-helix	469-472	4
α-helix	479-497	19
α-helix	503-504	2
β-strand	505	1	50
β-strand	509	1	50
β-strand	510-514	5	42
β-strand	517-521	5	42
α-helix	522-523	2
β-strand	526-527	2	51
β-strand	533-534	2	51
β-strand	543	1	52
α-helix	547-549	3
α-helix	551-556	6
β-strand	561-565	5	53
β-strand	574	1	52
α-helix	577-580	4
β-strand	585-589	5	53
β-strand	610	1	30
α-helix	611-613	3
α-helix	622	1
β-strand	623-624	2	54
α-helix	625	1
β-strand	632-634	3	55
β-strand	640-641	2	54
β-strand	646-648	3	56
β-strand	649-651	3	55
β-strand	658	1	57
β-strand	662-665	4	56
α-helix	670	1
β-strand	671-673	3	56
β-strand	677	1	57
β-strand	684	1	58
β-strand	693	1	59
β-strand	700	1	58
β-strand	706-708	3	60
β-strand	710	1	59
β-strand	722-724	3	60
β-strand	756-758	3	61
β-strand	763-765	3	61
α-helix	766-767	2
α-helix	768-771	4
β-strand	778-783	6	62
β-strand	788-793	6	62
α-helix	794-804	11
β-strand	808-813	6	62
α-helix	820-828	9
β-strand	852	1	63
β-strand	859	1	63
α-helix	861-863	3
α-helix	864-866	3
β-strand	876-877	2	64
β-strand	886-887	2	64
α-helix	890-898	9
β-strand	905-907	3	64

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C5	A	protein	1676	Homo sapiens	P01031 (AlphaFold model)
Complement component C6	B	protein	913	Homo sapiens	P13671 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4E0S_1 Complement C5 (chains A)
MGLLGILCFLIFLGKTWGQEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYP
DKKFSYSSGHVHLSSENKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPIT
YDNGFLFIHTDKPVYTPDQSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHI
GIISFPDFKIPSNPRYGMWTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGY
KNFKNFEITIKARYFYNKVVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVT
FDSETAVKELSYYSLEDLNNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATP
LFLKPGIPYPIKVQVKDSLDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASF
VLNLPSGVTVLEFNVKTDAPDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGE
HLNIIVTPKSPYIDKITHYNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRL
LVYYIVTGEQTAELVSDSVWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWV
ALAAVDSAVYGVQRGAKKPLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANAD
DSQENDEPCKEILRPRRTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISL
GPRCIKAFTECCVVASQLRANISHKDMQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLV
PRRKQLQFALPDSLTTWEIQGIGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQ
LKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTV
LPLEIGLHNINFSLETWFGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFP
YRIPLDLVPKTEIKRILSVKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFY
VFHYLETGNHWNIFHSDPLIEKQKLKKKLKEGMLSIMSYRNADYSYSVWKGGSASTWLTA
FALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEAREN
SLYLTAFTVIGIRKAFDICPLVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDK
THPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLN
LKDINYVNPVIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHK
GALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLK
IDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLK
ALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHR
PDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYA
YKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIM
GKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC

Sequence of entity 2 (B), FASTA

>4E0S_2 Complement component C6 (chains B)
CFCDHYAWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENFCEQICSKQETRECNWQRCPIN
CLLGDFGPWSDCDPCIEKQSKVRSVLRPSQFGGQPCTAPLVAFQPCIPSKLCKIEEADCK
NKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVCTRKYNPIPSVQLMGNGFHFLA
GEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVGFEVQTAEDDLKTDFYKDLTSL
GHNENQQGSFSSQGGSSFSVPIFYSSKRSENINHNSAFKQAIQASHKKDSSFIRIHKVMK
VLNFTTKAKDLHLSDVFLKALNHLPLEYNSALYSRIFDDFGTHYFTSGSLGGVYDLLYQF
SSEELKNSGLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSI
SLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELAPIVDLVRNIPCAV
TKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECLCVCQSGTYGENCEKQSPDYKS
NAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKRCEGEKRQEEDCTFSIMENNGQ
PCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQLYLVGEDVEISCLTGFETVGY
QYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQRLYRIGESIELTCPKGFVVAGP
SRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQSGSECICMSPEEDCSHHSEDLC
VFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDGRQLEWGLERTRLSSNSTKKES
CGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKMGSSTSEKTLNICEVGTIRCAN
RKMEILHPGKCLA

Ligands and cofactors

ID	Name	Formula	Copies
MAN	alpha-D-mannopyranose	C6 H12 O6	4
CA	Calcium ion	Ca	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex. Aleshin, A.E., Discipio, R.G., Stec, B. et al. J Biol Chem (2012) 287:19642-19652. DOI 10.1074/jbc.M112.361121 · PubMed

Other PDB entries of the same protein (UniProt P01031 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y6C 2.0 Å, X-ray structure analysis of human Complement Component 5 TE domain in complex with the…
5B71 2.11 Å, Crystal structure of complement C5 in complex with SKY59
4UU9 2.12 Å, Crystal structure of the human c5a in complex with MEDI7814 a neutralising antibody
7AD7 2.3 Å, Crystal structure of human complement C5 in complex with the K8 bovine knob domain…
5B4P 2.4 Å, Complex structure of human C5a and its binding repebody
4P39 2.4 Å, Crystal structure of the human C5aR antagonist C5a-A8
7OP0 2.57 Å, Crystal structure of complement C5 in complex with chemically synthesized K92 knob domain.
3HQA 2.59 Å, Crystal structure of human desarg-C5A
5HCC 2.59 Å, Ternary complex of human Complement C5 with Ornithodoros moubata OmCI and Dermacentor…
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
6RPT 2.7 Å, Structure of tick complement inhibitor CirpT1 complexed with macroglobubulin domain 4 of…
7AD6 2.75 Å, Crystal structure of human complement C5 in complex with the K92 bovine knob domain…

Browse structure collections

About this viewer

MolViewer shows 4E0S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.