4E50: Calmodulin and Ng peptide complex

Calmodulin and Ng peptide complex. Determined by X-ray diffraction at 2.7 Å resolution. Released 20 Mar 2013.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,280
Mol. weight: 20.66 kDa
Released: 20 Mar 2013

Explore 4E50 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4E50 contains 11 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
α-helix	7-19	13
β-strand	27-29	3	1
α-helix	30-32	3
α-helix	33-38	6
α-helix	47-50	4
β-strand	63-65	3	1
α-helix	66-92	27
β-strand	100	1	2
α-helix	103-112	10
α-helix	120-127	8
α-helix	131	1
β-strand	138	1	2
α-helix	140-143	4
α-helix	156-173	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin, Linker, IQ motif of Neurogranin	A	protein	185	Mus musculus	P0DP26 (AlphaFold model), P60761 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4E50_1 Calmodulin, Linker, IQ motif of Neurogranin (chains A)
MHHHHHHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI
NEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNL
GEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKGGGGGNAAAAKIQASFRGHMARKK
IKSGE

Primary citation

Structural basis for the interaction of unstructured neuron specific substrates neuromodulin and neurogranin with calmodulin. Kumar, V., Chichili, V.P.R., Zhong, L. et al. Sci Rep (2013) 3:1392-1392. DOI 10.1038/srep01392 · PubMed

Other PDB entries of the same protein (UniProt P0DP26 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7CQP 1.9 Å, Complex of TRPC4 and Calmodulin_Nlobe
3WFN 1.95 Å, Crystal Structure of Nav1.6 IQ motif in complex with apo-CaM
4HEX 2.0 Å, A novel conformation of calmodulin
2IX7 2.5 Å, Structure of apo-calmodulin bound to unconventional myosin V
4ZLK 2.5 Å, Crystal structure of mouse myosin-5a in complex with calcium-bound calmodulin
4E53 2.69 Å, Calmodulin and Nm peptide complex
9CFV 2.7 Å, Cryo-EM structure of delta-NTR myosin-1c bound to F-actin
9CFX 2.7 Å, Cryo-EM structure of myosin-1c bound to F-actin in the Rigor state
9CFU 2.8 Å, Cryo-EM structure of myosin-1c bound to F-actin in the ADP-A state
9CFW 3.0 Å, Cryo-EM structure of myosin-1c bound to F-actin in the ADP-B state
8PB1 3.5 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…
8W41 3.54 Å, Cryo-EM structure of Myosin VI in the autoinhibited state

Browse structure collections

About this viewer

MolViewer shows 4E50 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.