7CQP: Complex of TRPC4 and Calmodulin_Nlobe

Complex of TRPC4 and Calmodulin_Nlobe. Determined by X-ray diffraction at 1.9 Å resolution. Released 23 Jun 2021.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Mus musculus
Chains: 2
Atoms: 757
Mol. weight: 12.31 kDa
Ligands: CA
Released: 23 Jun 2021

Explore 7CQP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CQP contains 6 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	7-20	14
β-strand	27-28	2	1
α-helix	30-39	10
α-helix	46-56	11
β-strand	64-65	2	1
α-helix	66-77	12

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-15	8
α-helix	17-23	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin-1	B	protein	80	Mus musculus	P0DP26 (AlphaFold model)
Peptide from Short transient receptor potential channel 4	C	protein	30	Mus musculus	Q9QUQ5 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>7CQP_1 Calmodulin-1 (chains B)
GPMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA
DGNGTIDFPEFLTMMARKMK

Sequence of entity 2 (C), FASTA

>7CQP_2 Peptide from Short transient receptor potential channel 4 (chains C)
GPDKRKNLSLFDLTTLIHPRSAAIASERHN

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Calmodulin binds to Drosophila TRP with an unexpected mode. Chen, W., Shen, Z., Asteriti, S. et al. Structure (2021) 29:330-344.e4. DOI 10.1016/j.str.2020.11.016 · PubMed

Other PDB entries of the same protein (UniProt P0DP26 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3WFN 1.95 Å, Crystal Structure of Nav1.6 IQ motif in complex with apo-CaM
4HEX 2.0 Å, A novel conformation of calmodulin
2IX7 2.5 Å, Structure of apo-calmodulin bound to unconventional myosin V
4ZLK 2.5 Å, Crystal structure of mouse myosin-5a in complex with calcium-bound calmodulin
4E53 2.69 Å, Calmodulin and Nm peptide complex
4E50 2.7 Å, Calmodulin and Ng peptide complex
9CFV 2.7 Å, Cryo-EM structure of delta-NTR myosin-1c bound to F-actin
9CFX 2.7 Å, Cryo-EM structure of myosin-1c bound to F-actin in the Rigor state
9CFU 2.8 Å, Cryo-EM structure of myosin-1c bound to F-actin in the ADP-A state
9CFW 3.0 Å, Cryo-EM structure of myosin-1c bound to F-actin in the ADP-B state
8PB1 3.5 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…
8W41 3.54 Å, Cryo-EM structure of Myosin VI in the autoinhibited state

Browse structure collections

About this viewer

MolViewer shows 7CQP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.