4EDM: Beta-parvin CH2 domain

Crystal structure of beta-parvin CH2 domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 8 Aug 2012.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,262
Mol. weight: 31.18 kDa
Released: 8 Aug 2012

Explore 4EDM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4EDM contains 18 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	243-246	4
α-helix	254-268	15
α-helix	269-271	3
α-helix	286-295	10
α-helix	302-304	3
α-helix	312-328	17
α-helix	331-334	4
α-helix	338-342	5
α-helix	346-360	15

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	241-248	8
α-helix	252-268	17
α-helix	269-271	3
α-helix	286-295	10
α-helix	302-304	3
α-helix	312-329	18
α-helix	331-334	4
α-helix	338-342	5
α-helix	346-360	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-parvin	A, B	protein	133	Homo sapiens	Q9HBI1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4EDM_1 Beta-parvin (chains A, B)
GNSGRFERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLL
MGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLR
VLYNLFTKYKNVE

Primary citation

Structural basis for paxillin binding and focal adhesion targeting of beta-parvin. Stiegler, A.L., Draheim, K.M., Li, X. et al. J Biol Chem (2012) 287:32566-32577. DOI 10.1074/jbc.M112.367342 · PubMed

Other PDB entries of the same protein (UniProt Q9HBI1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EDL 2.1 Å, Crystal structure of beta-parvin CH2 domain
4EDN 2.9 Å, Crystal structure of beta-parvin CH2 domain in complex with paxillin LD1 motif

Browse structure collections

About this viewer

MolViewer shows 4EDM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.