4EFO: Ubiquitin-like domain of human TBK1

Crystal structure of the ubiquitin-like domain of human TBK1. Determined by X-ray diffraction at 1.77 Å resolution. Released 27 Jun 2012.

Method: X-ray diffraction
Resolution: 1.77 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,615
Mol. weight: 21.88 kDa
Released: 27 Jun 2012

Explore 4EFO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4EFO contains 13 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	301-303	3
α-helix	305-307	3
β-strand	308-315	8	1
β-strand	320-327	8	1
β-strand	331	1	2
α-helix	332-343	12
α-helix	347-349	3
β-strand	350-354	5	1
β-strand	357-359	3	1
β-strand	366	1	2
α-helix	367-369	3
α-helix	371-372	2
β-strand	374	1	3
β-strand	377	1	3
α-helix	378	1
β-strand	379-383	5	1

Chain B: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	305-307	3
β-strand	308-315	8	4
β-strand	320-327	8	4
β-strand	331	1	5
α-helix	332-343	12
α-helix	347-349	3
β-strand	350-354	5	4
β-strand	357-359	3	4
β-strand	366	1	5
α-helix	367-369	3
α-helix	371-372	2
α-helix	378	1
β-strand	379-383	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase TBK1	A, B	protein	94	Homo sapiens	Q9UHD2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4EFO_1 Serine/threonine-protein kinase TBK1 (chains A, B)
GPLGSTSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEG
RRLVLEPGRLAQHFPKTTEENPIFVVSLERPHRD

Primary citation

Crystal structure of the ubiquitin-like domain of human TBK1. Li, J., Li, J., Miyahira, A. et al. Protein Cell (2012) 3:383-391. DOI 10.1007/s13238-012-2929-1 · PubMed

Other PDB entries of the same protein (UniProt Q9UHD2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EP6 1.45 Å, The crystal structure of NAP1 in complex with TBK1
4EUU 1.8 Å, Structure of BX-795 Complexed with Human TBK1 Kinase Domain Phosphorylated on Ser172
5EOF 2.05 Å, Crystal structure of OPTN NTD and TBK1 CTD complex
4IM0 2.4 Å, Structure of Tank-Binding Kinase 1
4IM2 2.5 Å, Structure of Tank-Binding Kinase 1
5EOA 2.5 Å, Crystal structure of OPTN E50K mutant and TBK1 complex
4EUT 2.6 Å, Structure of BX-795 Complexed with Unphosphorylated Human TBK1 Kinase-ULD Domain
4IWO 2.61 Å, Crystal structure and mechanism of activation of TBK1
6RSU 2.75 Å, TBK1 in complex with Inhibitor compound 35
4IWQ 3.0 Å, Crystal structure and mechanism of activation of TBK1
4IWP 3.06 Å, Crystal structure and mechanism of activation of TBK1
6RSR 3.15 Å, TBK1 in complex with compound 2

Browse structure collections

About this viewer

MolViewer shows 4EFO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.