5EOA: OPTN E50K mutant and TBK1 complex

Crystal structure of OPTN E50K mutant and TBK1 complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 28 Sept 2016.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,913
Mol. weight: 31.8 kDa
Released: 28 Sept 2016

Explore 5EOA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EOA contains 4 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	37-98	62

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	37-101	65

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	680-714	35

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	683-717	35

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Optineurin	A, B	protein	82	Homo sapiens	Q96CV9 (AlphaFold model)
Serine/threonine-protein kinase TBK1	C, D	protein	57	Homo sapiens	Q9UHD2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5EOA_1 Optineurin (chains A, B)
GPGSHLAHPNLDTFTPEELLQQMKELLTKNHQLKEAMKLNNQAMKGRFEELSAWTEKQKE
ERQFFEIQSKEAKERLMALSHE

Sequence of entity 2 (C, D), FASTA

>5EOA_2 Serine/threonine-protein kinase TBK1 (chains C, D)
GPGSYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL

Primary citation

Structural insights into the interaction and disease mechanism of neurodegenerative disease-associated optineurin and TBK1 proteins. Li, F., Xie, X., Wang, Y. et al. Nat Commun (2016) 7:12708-12708. DOI 10.1038/ncomms12708 · PubMed

Other PDB entries of the same protein (UniProt Q96CV9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VTV 1.7 Å, Crystal structure of Optineurin LIR-fused human LC3B_2-119
9B0B 1.7 Å, Structure of Optineurin bound to HOIP NZF1 domain
9B12 1.81 Å, Structure of Optineurin bound to HOIP NZF1 domain and M1-linked diubiquitin, crystal…
9M0O 1.83 Å, Crystal structure of OPTN 138-170 in complex with GTP-bound RAB8A1-176 (Q67L)
9IKQ 1.93 Å, Crystal structure of OPTN LZD in complex with GTP-bound Rab8a(Q67L)
7CZM 2.0 Å, Crystal structure of FIP200 Claw/p-OPtineurin LIR complex
5EOF 2.05 Å, Crystal structure of OPTN NTD and TBK1 CTD complex
9B0Z 2.41 Å, Structure of Optineurin bound to HOIP NZF1 domain and M1-linked diubiquitin, crystal…
3VTW 2.52 Å, Crystal structure of T7-tagged Optineurin LIR-fused human LC3B_2-119
5B83 2.69 Å, Crystal structure of Optineurin UBAN in complex with linear ubiquitin
2LO4 NMR Solution Structure of Optineurin Zinc-finger Domain
2LUE LC3B OPTN-LIR Ptot complex structure

Browse structure collections

About this viewer

MolViewer shows 5EOA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.