4EKC: Human regulator of G protein signaling 2

Structure of human regulator of G protein signaling 2 (RGS2) in complex with murine Galpha-q(R183C). Determined by X-ray diffraction at 7.4 Å resolution. Released 30 Jan 2013.

Method: X-ray diffraction
Resolution: 7.4 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 7,392
Mol. weight: 114.15 kDa
Ligands: ALF, MG, GDP
Released: 30 Jan 2013

Explore 4EKC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4EKC contains 60 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	39-46	8	1
α-helix	52-62	11
α-helix	72-93	22
α-helix	94-98	5
α-helix	99-101	3
α-helix	106-114	9
α-helix	126-137	12
α-helix	139-146	8
α-helix	148-150	3
α-helix	157-161	5
α-helix	164-167	4
α-helix	176-180	5
β-strand	189-195	7	1
β-strand	200-206	7	1
α-helix	210-212	3
α-helix	216-219	4
β-strand	223-231	9	1
α-helix	232-235	4
β-strand	238	1	2
β-strand	246	1	2
α-helix	247-260	14
α-helix	262-264	3
β-strand	268-274	7	1
α-helix	276-282	7
α-helix	288-290	3
α-helix	302-314	13
β-strand	325-328	4	1
α-helix	334-352	19

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	74-78	5
α-helix	84-89	6
α-helix	92-103	12
α-helix	108-120	13
α-helix	125-139	15
α-helix	153-161	9
α-helix	171-180	10
α-helix	181-185	5
α-helix	186-191	6
α-helix	193-196	4

Chain C: 19 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	39-45	7	3
α-helix	52-62	11
α-helix	72-93	22
α-helix	94-98	5
α-helix	99-101	3
α-helix	106-114	9
α-helix	126-137	12
α-helix	139-146	8
α-helix	148-150	3
α-helix	157-161	5
α-helix	164-167	4
α-helix	176-180	5
β-strand	189-195	7	3
β-strand	200-206	7	3
α-helix	210-212	3
α-helix	216-219	4
β-strand	223-231	9	3
β-strand	238	1	4
β-strand	246	1	4
α-helix	247-260	14
α-helix	262-264	3
β-strand	268-274	7	3
α-helix	276-282	7
α-helix	288-290	3
α-helix	302-314	13
β-strand	325-328	4	3
α-helix	334-352	19

Chain D: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	74-78	5
α-helix	84-89	6
α-helix	92-103	12
α-helix	108-120	13
α-helix	125-135	11
α-helix	136-140	5
α-helix	153-161	9
α-helix	171-180	10
α-helix	181-185	5
α-helix	186-191	6
α-helix	193-196	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanine nucleotide-binding protein G(q) subunit alpha	A, C	protein	347	Mus musculus	P21279 (AlphaFold model)
Regulator of G-protein signaling 2	B, D	protein	137	Homo sapiens	P41220 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4EKC_1 Guanine nucleotide-binding protein G(q) subunit alpha (chains A, C)
GAMGSARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDK
RGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFDVPDYAAI
KSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVCVPTTGIIEY
PFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESK
ALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKM
FVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV

Sequence of entity 2 (B, D), FASTA

>4EKC_2 Regulator of G-protein signaling 2 (chains B, D)
GEFGSPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQ
KLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSY
PRFLESEFYQDLCKKPQ

Ligands and cofactors

ID	Name	Formula	Copies
ALF	Tetrafluoroaluminate ion	Al F4	2
MG	Magnesium ion	Mg	2
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	2

Primary citation

Structural and functional analysis of the regulator of G protein signaling 2-g alpha q complex. Nance, M.R., Kreutz, B., Tesmer, V.M. et al. Structure (2013) 21:438-448. DOI 10.1016/j.str.2012.12.016 · PubMed

Other PDB entries of the same protein (UniProt P21279 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5DO9 2.6 Å, Structure of regulator of G protein signaling 8 (RGS8) in complex with AlF4-activated…
7SQ2 2.6 Å, Reprocessed and refined structure of Phospholipase C-beta and Gq signaling complex
4EKD 2.71 Å, Structure of human regulator of G protein signaling 2 (RGS2) in complex with murine…
8YFS 2.8 Å, MRGPRE-Gq-scFv16-complex
3AH8 2.9 Å, Structure of heterotrimeric G protein Galpha-q beta gamma in complex with an inhibitor…
4QJ3 3.0 Å, Structure of a fragment of human phospholipase C-beta3 delta472-559, in complex with…
2BCJ 3.06 Å, Crystal Structure of G Protein-Coupled Receptor Kinase 2 in Complex with Galpha-q and…
4QJ4 3.3 Å, Structure of a fragment of human phospholipase C-beta3 delta472-569, bound to IP3 and in…
4QJ5 3.41 Å, Structure of a fragment of human phospholipase C-beta3 delta472-581, bound to IP3 and in…
2RGN 3.5 Å, Crystal Structure of p63RhoGEF complex with Galpha-q and RhoA
4GNK 4.0 Å, Crystal structure of Galphaq in complex with full-length human PLCbeta3

Browse structure collections

About this viewer

MolViewer shows 4EKC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.