4ERS: Fab light chain

A Molecular Basis for Negative Regulation of the Glucagon Receptor. Determined by X-ray diffraction at 2.64 Å resolution. Released 29 Aug 2012.

Method: X-ray diffraction
Resolution: 2.64 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,285
Mol. weight: 60.1 kDa
Ligands: NAG
Released: 29 Aug 2012

Explore 4ERS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ERS contains 21 α-helices and 52 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	31-49	19
α-helix	51-53	3
β-strand	57-58	2	11
β-strand	61-62	2	12
β-strand	67-68	2	12
β-strand	71-72	2	11
β-strand	75-80	6	13
α-helix	81-82	2
β-strand	95-100	6	13
β-strand	106	1	13
α-helix	107	1
β-strand	108	1	14
β-strand	114	1	14
β-strand	117	1	13

Chain H: 10 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	217-221	5	6
β-strand	224-226	3	7
β-strand	232-239	8	6
α-helix	243-245	3
β-strand	247-253	7	7
β-strand	260-265	6	7
β-strand	273-274	2	7
α-helix	276-278	3
β-strand	282-287	6	6
α-helix	288-290	3
β-strand	292-297	6	6
α-helix	302-304	3
β-strand	306-317	12	7
β-strand	324-332	9	7
β-strand	336-340	5	7
α-helix	343-345	3
β-strand	346	1	8
α-helix	347-348	2
β-strand	349-353	5	9
β-strand	364-374	11	9
β-strand	375	1	8
β-strand	380-383	4	10
α-helix	384-386	3
β-strand	392-394	3	9
α-helix	395-397	3
β-strand	398-399	2	9
β-strand	405-414	10	9
α-helix	415-417	3
β-strand	423-429	7	10
α-helix	430-432	3
β-strand	434-440	7	10

Chain L: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-65	4	1
β-strand	70-75	6	1
β-strand	85-90	6	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2
β-strand	111	1	3
α-helix	112-113	2
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	153-154	2	5
β-strand	159-163	5	4
α-helix	164-167	4
β-strand	173-182	10	4
α-helix	183-186	4
β-strand	192-197	6	5
β-strand	205-209	5	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab light chain	L	protein	214	Homo sapiens
Fab heavy chain	H	protein	231	Homo sapiens
Glucagon receptor	A	protein	96	Homo sapiens	P47871 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>4ERS_1 Fab light chain (chains L)
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLESGVPS
RFSGSGSGTEFTLTISSVQPEDFVTYYCLQHNSNPLTFGGGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 2 (H), FASTA

>4ERS_2 Fab heavy chain (chains H)
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVMYYDGSNKDY
VDSVKGRFTISRDNSKNTLYLQMNRLRAEDTAVYYCAREKDHYDILTGYNYYYGLDVWGQ
GTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHT
FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC

Sequence of entity 3 (A), FASTA

>4ERS_3 Glucagon receptor (chains A)
VMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPW
HHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQM

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Molecular basis for negative regulation of the glucagon receptor. Koth, C.M., Murray, J.M., Mukund, S. et al. Proc Natl Acad Sci U S A (2012) 109:14393-14398. DOI 10.1073/pnas.1206734109 · PubMed

Other PDB entries of the same protein (UniProt P47871 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CZF 1.2 Å, Crystal structure of HLA-B*2709 complexed with the glucagon receptor (GR) peptide…
2A83 1.4 Å, Crystal structure of hla-b*2705 complexed with the glucagon receptor (gr) peptide…
9N04 2.3 Å, Cryo-EM structure of GCGR-Gs complex with peptide 15
9N0E 2.3 Å, Cryo-EM structure of GCGR-Gs complex with oxyntomodulin
5EE7 2.5 Å, Crystal structure of the human glucagon receptor (GCGR) in complex with the antagonist…
9XN4 2.53 Å, Glucagon receptor-Gs complex activated by the small molecule agonist SIM1
8WG8 2.71 Å, Cryo-EM structures of peptide free and Gs-coupled GCGR
4LF3 2.73 Å, Inhibitory Mechanism of an Allosteric Antibody Targeting the Glucagon Receptor
8JIU 2.76 Å, Cryo-EM structure of the GLP-1R/GCGR dual agonist SAR425899-bound human GCGR-Gs complex
8YW5 2.84 Å, Cryo-EM structure of the retatrutide-bound human GCGR-Gs complex
8FU6 2.9 Å, GCGR-Gs complex in the presence of RAMP2
8JIT 2.91 Å, Cryo-EM structure of the GLP-1R/GCGR dual agonist MEDI0382-bound human GCGR-Gs complex

Browse structure collections

About this viewer

MolViewer shows 4ERS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.