5EE7: Human glucagon receptor

Crystal structure of the human glucagon receptor (GCGR) in complex with the antagonist MK-0893. Determined by X-ray diffraction at 2.5 Å resolution. Released 20 Apr 2016.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Homo sapiens, Enterobacteria phage T4
Chains: 1
Atoms: 3,619
Mol. weight: 56.37 kDa
Ligands: 5MV, OLA, PE5, TLA
Released: 20 Apr 2016

Explore 5EE7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EE7 contains 25 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	139-165	27
α-helix	167-169	3
α-helix	172-198	27
α-helix	213-215	3
α-helix	218-253	36
α-helix	1001-1009	9
β-strand	1012-1013	2	1
β-strand	1014	1	2
β-strand	1015-1017	3	1
β-strand	1023-1026	4	1
β-strand	1029-1032	4	1
α-helix	1037-1048	12
β-strand	1055	1	2
α-helix	1058-1078	21
α-helix	1083-1087	5
α-helix	1091-1104	14
α-helix	1106-1110	5
α-helix	1113-1120	8
α-helix	1124-1133	10
α-helix	1135-1139	5
α-helix	1141-1153	13
α-helix	264-268	5
α-helix	269-273	5
α-helix	274-289	16
α-helix	305-307	3
α-helix	308-334	27
α-helix	343-369	27
α-helix	379-389	11
α-helix	392-397	6
α-helix	398-402	5
α-helix	405-417	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glucagon receptor,Endolysin,Glucagon receptor	A	protein	452	Homo sapiens, Enterobacteria phage T4	P00720, P47871 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5EE7_1 Glucagon receptor,Endolysin,Glucagon receptor (chains A)
KGYSSFQVMYTVGYSLSLAALLLALAILGGLSKLHCTANAIHANLFLSFVLKASAVLFID
GLLRTRYSQKIEDDLSVSTWLSDGAVAACRVAAVFMQYGIVANYCWLLVEGLYLHNLLGL
NIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKD
EAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRML
QQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYPERSFFSLYLGIGWGAPALF
VVPWAVVKCLFENVQCWTSNDNMGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQM
HHTDYAFRLAKSTLTLIPLLGVHFVVFAFVTDEHAQGTLRSAKLFFDLALSSFQGLLVAV
LYCFLNKEVQSELRRRWHRAAAHHHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
5MV	3-[[4-[(1~{S})-1-[3-[3,5-bis(chloranyl)phenyl]-5-(6-methoxynaphthalen-2-yl)pyra…	C32 H27 Cl2 N3 O4	1
OLA	Oleic acid	C18 H34 O2	14
PE5	3,6,9,12,15,18,21,24-octaoxahexacosan-1-ol	C18 H38 O9	1
TLA	L(+)-tartaric acid	C4 H6 O6	1

Primary citation

Extra-helical binding site of a glucagon receptor antagonist. Jazayeri, A., Dore, A.S., Lamb, D. et al. Nature (2016) 533:274-277. DOI 10.1038/nature17414 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 5EE7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.