4ES7: Protein HC from Homo sapiens

crystal structure of protein HC from Homo sapiens at 2 angstrom. Determined by X-ray diffraction at 2.0 Å resolution. Released 24 Apr 2013.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,406
Mol. weight: 22.95 kDa
Released: 24 Apr 2013

Explore 4ES7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ES7 contains 8 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	5-6	2
α-helix	11-13	3
β-strand	16-25	10	1
α-helix	28-33	6
α-helix	34-36	3
β-strand	38	1	2
β-strand	40-46	7	1
β-strand	52-61	10	1
β-strand	64-74	11	1
β-strand	80-85	6	1
β-strand	90-99	10	1
β-strand	104-113	10	1
β-strand	119-126	8	1
α-helix	133-144	12
α-helix	150-152	3
β-strand	153-155	3	1
α-helix	156	1
β-strand	157	1	2
α-helix	158	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein AMBP	A	protein	201	Homo sapiens	P02760 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4ES7_1 Protein AMBP (chains A)
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSDNIQVQENFNISRIYGKWYNLAIGST
CPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKS
KWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGV
GIPEDSIFTMADRGECVPGEQ

Primary citation

crystal structure of protein HC from Home sapiens at 2 angstrom. Zhang, Y.L., Gao, Z.Q., Wang, D.Q. et al. To be published.

Other PDB entries of the same protein (UniProt P02760 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6EJA 1.94 Å, Human Xylosyltransferase 1 in complex with peptide QEEEYSGGGQGG
6EJ7 2.0 Å, Human Xylosyltransferase 1 in complex with UDP-xylose and peptide QEEEGAGGGQGG
6EJ9 2.02 Å, Human Xylosyltransferase 1 in complex with peptide QEPEGSGGGQGG
6EJC 2.06 Å, Human Xylosyltransferase 1 in complex with peptide QEEEGSGVGQGG
6EJ8 2.09 Å, Human Xylosyltransferase 1 in complex with peptide QEEEGSGGGQGG
3QKG 2.3 Å, Crystal structure of alpha-1-microglobulin at 2.3 A resolution
1BIK 2.5 Å, X-ray structure of bikunin from the human inter-alpha-inhibitor complex
4U30 2.5 Å, Human mesotrypsin complexed with bikunin Kunitz domain 2
6EJB 2.56 Å, Human Xylosyltransferase 1 in complex with peptide QEEEGSAGGQGG
6EJD 2.68 Å, Human Xylosyltransferase 1 in complex with peptide QEEEGSGGPQGG

Browse structure collections

About this viewer

MolViewer shows 4ES7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.