4EZS: Substrate binding domain of E.coli DnaK

Crystal structure of the substrate binding domain of E.coli DnaK in complex with metchnikowin (residues 20 to 26). Determined by X-ray diffraction at 1.9 Å resolution. Released 24 Apr 2013.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Escherichia coli, Drosophila melanogaster
Chains: 2
Atoms: 1,821
Mol. weight: 24.88 kDa
Released: 24 Apr 2013

Explore 4EZS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4EZS contains 9 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	394	1	1
β-strand	399-403	5	2
β-strand	407-412	6	2
α-helix	416	1
β-strand	417	1	1
β-strand	420-426	7	3
β-strand	427-428	2	4
β-strand	436-442	7	2
β-strand	447	1	2
α-helix	448-450	3
β-strand	452-459	8	2
α-helix	462-463	2
β-strand	472-478	7	3
β-strand	484-490	7	3
β-strand	496-501	6	3
α-helix	509-521	13
α-helix	523-553	31
α-helix	554-556	3
α-helix	559-575	17
α-helix	581-594	14
α-helix	596-605	10

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	22-23	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chaperone protein DnaK	A	protein	219	Escherichia coli	P0A6Y8 (AlphaFold model)
Metchnikowin	B	protein	8	Drosophila melanogaster	Q24395 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4EZS_1 Chaperone protein DnaK (chains A)
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRA
ADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLN
EDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESA
LTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA

Sequence of entity 2 (B), FASTA

>4EZS_2 Metchnikowin (chains B)
PRPGPIYY

Primary citation

Structural studies of DnaK in complex with proline rich antimicrobial peptides reveal two different peptide binding modes. Zahn, M., Straeter, N. To be published.

Other PDB entries of the same protein (UniProt P0A6Y8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4F01 1.4 Å, Crystal structure of an artificial dimeric DnaK complex
7RAX 1.41 Å, ATP-binding state of the nucleotide-binding domain of Hsp70 DnaK mutant T199A
13JG 1.52 Å, E. coli DnaK bound to peptide PA1, structure B
4HY9 1.55 Å, Crystal structure of the substrate binding domain of E.coli DnaK in complex with…
4JNF 1.62 Å, Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP
4EZP 1.65 Å, Crystal structure of the substrate binding domain of E.coli DnaK in complex with…
4EZX 1.7 Å, Crystal structure of the substrate binding domain of E.coli DnaK in complex with the…
4HYB 1.7 Å, Crystal structure of the substrate binding domain of E.coli DnaK in complex with…
4R5K 1.75 Å, Crystal structure of the DnaK C-terminus (Dnak-SBD-B)
4EZN 1.8 Å, Crystal structure of the substrate binding domain of E.coli DnaK in complex with…
4EZW 1.8 Å, Crystal structure of the substrate binding domain of E.coli DnaK in complex with the…
4JWC 1.8 Å, Crystal structure of the substrate binding domain of E.coli DnaK in complex with bovine…

Browse structure collections

About this viewer

MolViewer shows 4EZS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.