Crystal structure of the substrate binding domain of E.coli DnaK in complex with the designer peptide NRLLLTG. Determined by X-ray diffraction at 1.8 Å resolution. Released 17 Apr 2013.
Explore 4EZW in 3D Show helices and sheets RCSB PDB PDBe
4EZW contains 32 α-helices and 52 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 392-395 | 4 | 1 |
| β-strand | 399-403 | 5 | 2 |
| β-strand | 407-412 | 6 | 2 |
| β-strand | 416-417 | 2 | 1 |
| β-strand | 420-426 | 7 | 3 |
| β-strand | 427-428 | 2 | 4 |
| β-strand | 435-442 | 8 | 2 |
| β-strand | 447 | 1 | 2 |
| α-helix | 448-450 | 3 | |
| β-strand | 452-460 | 9 | 2 |
| α-helix | 462-464 | 3 | |
| β-strand | 472-478 | 7 | 3 |
| β-strand | 484-490 | 7 | 3 |
| β-strand | 496-501 | 6 | 3 |
| α-helix | 509-521 | 13 | |
| α-helix | 523-552 | 30 | |
| α-helix | 559-577 | 19 | |
| α-helix | 581-593 | 13 | |
| α-helix | 596-600 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 392-395 | 4 | 5 |
| β-strand | 399-403 | 5 | 6 |
| β-strand | 407-412 | 6 | 6 |
| β-strand | 416-417 | 2 | 5 |
| β-strand | 420-426 | 7 | 7 |
| β-strand | 427-428 | 2 | 8 |
| β-strand | 435-442 | 8 | 6 |
| β-strand | 447 | 1 | 6 |
| α-helix | 448-450 | 3 | |
| β-strand | 452-460 | 9 | 6 |
| α-helix | 462-464 | 3 | |
| β-strand | 472-478 | 7 | 7 |
| β-strand | 484-490 | 7 | 7 |
| β-strand | 496-501 | 6 | 7 |
| α-helix | 509-521 | 13 | |
| α-helix | 523-553 | 31 | |
| α-helix | 554-556 | 3 | |
| α-helix | 559-576 | 18 | |
| α-helix | 581-593 | 13 | |
| α-helix | 596-602 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 392-394 | 3 | 1 |
| β-strand | 399-403 | 5 | 9 |
| β-strand | 407-412 | 6 | 9 |
| β-strand | 417 | 1 | 1 |
| β-strand | 420-426 | 7 | 10 |
| β-strand | 427-428 | 2 | 11 |
| β-strand | 436-442 | 7 | 9 |
| β-strand | 447 | 1 | 9 |
| α-helix | 448-450 | 3 | |
| β-strand | 452-459 | 8 | 9 |
| α-helix | 462-464 | 3 | |
| β-strand | 472-478 | 7 | 10 |
| β-strand | 484-490 | 7 | 10 |
| β-strand | 496-501 | 6 | 10 |
| α-helix | 509-521 | 13 | |
| α-helix | 523-553 | 31 | |
| α-helix | 554-556 | 3 | |
| α-helix | 559-576 | 18 | |
| α-helix | 581-594 | 14 | |
| α-helix | 596-602 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 392-394 | 3 | 5 |
| β-strand | 399-403 | 5 | 12 |
| β-strand | 407-412 | 6 | 12 |
| α-helix | 416 | 1 | |
| β-strand | 417 | 1 | 5 |
| β-strand | 420-426 | 7 | 13 |
| β-strand | 427-428 | 2 | 14 |
| β-strand | 435-442 | 8 | 12 |
| β-strand | 447 | 1 | 12 |
| α-helix | 448-450 | 3 | |
| β-strand | 452-460 | 9 | 12 |
| α-helix | 462-463 | 2 | |
| β-strand | 472-478 | 7 | 13 |
| β-strand | 484-490 | 7 | 13 |
| β-strand | 496-501 | 6 | 13 |
| α-helix | 509-521 | 13 | |
| α-helix | 523-553 | 31 | |
| α-helix | 554-556 | 3 | |
| α-helix | 559-577 | 19 | |
| α-helix | 581-593 | 13 | |
| α-helix | 596-603 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chaperone protein DnaK | A, B, C, D | protein | 219 | Escherichia coli | P0A6Y8 (AlphaFold model) |
| synthetic peptide NRLLLTG | E, F, G, H | protein | 7 |
>4EZW_1 Chaperone protein DnaK (chains A, B, C, D) VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRA ADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLN EDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESA LTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA
>4EZW_2 synthetic peptide NRLLLTG (chains E, F, G, H) NRLLLTG
Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK. Zahn, M., Berthold, N., Kieslich, B. et al. J Mol Biol (2013) 425:2463-2479. DOI 10.1016/j.jmb.2013.03.041 · PubMed
Other PDB entries of the same protein (UniProt P0A6Y8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4EZW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.