4F7O: CSN5

Crystal structure of CSN5. Determined by X-ray diffraction at 2.6 Å resolution. Released 23 Jan 2013.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,807
Mol. weight: 59.39 kDa
Ligands: SCN, ZN
Released: 23 Jan 2013

Explore 4F7O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4F7O contains 14 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	6-16	11
β-strand	21-22	2	1
α-helix	33-42	10
β-strand	54-58	5	2
α-helix	59-71	13
α-helix	76-77	2
β-strand	78-86	9	2
β-strand	89-97	9	2
α-helix	104-107	4
α-helix	112-124	13
β-strand	129	1	3
β-strand	133-139	7	2
α-helix	149-161	13
β-strand	167-170	4	2
β-strand	183-188	6	2
β-strand	221-223	3	2
β-strand	225-229	5	2
β-strand	230-231	2	1
α-helix	235-250	16

Chain B: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	6-16	11
β-strand	20	1	4
α-helix	33-42	10
β-strand	45	1	5
β-strand	48	1	5
β-strand	54-58	5	4
α-helix	59-71	13
β-strand	78-86	9	4
β-strand	89-97	9	4
α-helix	112-126	15
β-strand	130	1	3
β-strand	133-139	7	4
α-helix	150-161	12
β-strand	166-171	6	4
β-strand	182-188	7	4
β-strand	221-223	3	4
β-strand	225-229	5	4
α-helix	235-251	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
COP9 signalosome complex subunit 5	A, B	protein	257	Homo sapiens	Q92905 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4F7O_1 COP9 signalosome complex subunit 5 (chains A, B)
MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISAL
ALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY
IENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGK
VNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLEL
LWNKYWVNTLSSSSLLT

Ligands and cofactors

ID	Name	Formula	Copies
SCN	Thiocyanate ion	C N S	3
ZN	Zinc ion	Zn	2

Primary citation

Insights into the regulation of the human COP9 signalosome catalytic subunit, CSN5/Jab1. Echalier, A., Pan, Y., Birol, M. et al. Proc Natl Acad Sci U S A (2013) 110:1273-1278. DOI 10.1073/pnas.1209345110 · PubMed

Other PDB entries of the same protein (UniProt Q92905 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5JOH 1.99 Å, Crystal structure of CSN5(2-257) in complex with CNS5i-1b
5M5Q 2.2 Å, COPS5(2-257) in complex with a azaindole (compound 4)
5JOG 2.46 Å, Crystal structure of CSN5(2-257) in complex with CNS5i-3
9QO4 2.95 Å, Dissociation-state-3 of 9-subunit CSN and SCF (SKP1-SKP2-CKS1) complex
9EFQ 2.96 Å, Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-2
9PH4 3.0 Å, Cryo-EM structure of COP9 signalosome in complex with CSN5i-1a
9QO6 3.0 Å, 9-subunit COP9 signalosome complex
9EFV 3.03 Å, Cryo-EM structure of CSN-N8CUL1 in complex with CSN5i-3
9EFM 3.16 Å, Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-1
9QO1 3.23 Å, Activated 9-subunit COP9 signalosome and neddylated SCF (SKP1-SKP2-CKS1) complex structure
9QO0 3.26 Å, Pre-activated 9-subunit COP9 signalosome and neddylated SCF (Skp1-Skp2-Cks1) complex…
9E77 3.3 Å, Cryo-EM structure of CSN-N8 in complex with CSN5i-3

Browse structure collections

About this viewer

MolViewer shows 4F7O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.