Crystal Structure of the human BTN3A1 ectodomain. Determined by X-ray diffraction at 1.94 Å resolution. Released 8 Aug 2012.
Explore 4F80 in 3D Show helices and sheets RCSB PDB PDBe
4F80 contains 8 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-5 | 3 | 1 |
| α-helix | 10 | 1 | |
| β-strand | 11-14 | 4 | 2 |
| β-strand | 19-26 | 8 | 1 |
| β-strand | 35-40 | 6 | 2 |
| β-strand | 46-51 | 6 | 2 |
| β-strand | 54-55 | 2 | 2 |
| α-helix | 57-59 | 3 | |
| β-strand | 68-71 | 4 | 1 |
| α-helix | 75-77 | 3 | |
| β-strand | 79-84 | 6 | 1 |
| α-helix | 89-91 | 3 | |
| β-strand | 93-101 | 9 | 2 |
| β-strand | 104-115 | 12 | 2 |
| β-strand | 116 | 1 | 3 |
| α-helix | 119-121 | 3 | |
| β-strand | 122-129 | 8 | 4 |
| β-strand | 132-142 | 11 | 4 |
| β-strand | 143 | 1 | 3 |
| α-helix | 145-146 | 2 | |
| β-strand | 147-151 | 5 | 5 |
| β-strand | 157 | 1 | 5 |
| β-strand | 161-162 | 2 | 4 |
| α-helix | 163-165 | 3 | |
| β-strand | 166-167 | 2 | 4 |
| α-helix | 172 | 1 | |
| β-strand | 173-181 | 9 | 4 |
| β-strand | 189-195 | 7 | 5 |
| β-strand | 200-206 | 7 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Butyrophilin subfamily 3 member A1 | A | protein | 226 | Homo sapiens | O00481 (AlphaFold model) |
>4F80_1 Butyrophilin subfamily 3 member A1 (chains A) ADLQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVE DRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAAL GSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAA SVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQHHHHHH
The molecular basis for modulation of human V(gamma)9V(delta)2 T cell responses by CD277/Butyrophilin-3 (BTN3A)-specific antibodies. Palakodeti, A., Sandstrom, A., Sundaresan, L. et al. J Biol Chem (2012) 287:32780-32790. DOI 10.1074/jbc.M112.384354 · PubMed
Other PDB entries of the same protein (UniProt O00481 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4F80 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.