Crystal structure of intracellular B30.2 domain of BTN3A1 bound to malonate. Determined by X-ray diffraction at 1.6 Å resolution. Released 13 Sept 2017.
Explore 5LYG in 3D Show helices and sheets RCSB PDB PDBe
5LYG contains 4 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 328-336 | 9 | |
| β-strand | 338-339 | 2 | 1 |
| β-strand | 344 | 1 | 2 |
| β-strand | 353-355 | 3 | 1 |
| β-strand | 361-364 | 4 | 1 |
| β-strand | 383-385 | 3 | 3 |
| β-strand | 386 | 1 | 2 |
| β-strand | 390 | 1 | 3 |
| β-strand | 394-400 | 7 | 1 |
| β-strand | 407-413 | 7 | 3 |
| α-helix | 426-428 | 3 | |
| β-strand | 430-436 | 7 | 3 |
| β-strand | 440-443 | 4 | 3 |
| β-strand | 449-450 | 2 | 3 |
| β-strand | 459-465 | 7 | 1 |
| β-strand | 470-475 | 6 | 1 |
| β-strand | 481-485 | 5 | 1 |
| β-strand | 494-499 | 6 | 3 |
| α-helix | 507 | 1 | |
| β-strand | 508-511 | 4 | 1 |
| α-helix | 512 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Butyrophilin subfamily 3 member A1 | A | protein | 187 | Homo sapiens | O00481 (AlphaFold model) |
>5LYG_1 Butyrophilin subfamily 3 member A1 (chains A) SAYNEWKKALFKPADVILDPKTANPILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVLG CESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKGWVKMTPENGFWTMGLTDGNKYRTLTE PRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSFSEALYPVFRILTLEPT ALTICPA
| ID | Name | Formula | Copies |
|---|---|---|---|
| MLI | Malonate ion | C3 H2 O4 | 1 |
Water and common crystallization additives (EDO) are not listed.
BTN3A1 Discriminates gamma delta T Cell Phosphoantigens from Nonantigenic Small Molecules via a Conformational Sensor in Its B30.2 Domain. Salim, M., Knowles, T.J., Baker, A.T. et al. ACS Chem Biol (2017) 12:2631-2643. DOI 10.1021/acschembio.7b00694 · PubMed
Other PDB entries of the same protein (UniProt O00481 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5LYG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.