4F80: Human BTN3A1 ectodomain

Crystal Structure of the human BTN3A1 ectodomain. Determined by X-ray diffraction at 1.94 Å resolution. Released 8 Aug 2012.

Method: X-ray diffraction
Resolution: 1.94 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,634
Mol. weight: 24.47 kDa
Released: 8 Aug 2012

Explore 4F80 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4F80 contains 8 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	1
α-helix	10	1
β-strand	11-14	4	2
β-strand	19-26	8	1
β-strand	35-40	6	2
β-strand	46-51	6	2
β-strand	54-55	2	2
α-helix	57-59	3
β-strand	68-71	4	1
α-helix	75-77	3
β-strand	79-84	6	1
α-helix	89-91	3
β-strand	93-101	9	2
β-strand	104-115	12	2
β-strand	116	1	3
α-helix	119-121	3
β-strand	122-129	8	4
β-strand	132-142	11	4
β-strand	143	1	3
α-helix	145-146	2
β-strand	147-151	5	5
β-strand	157	1	5
β-strand	161-162	2	4
α-helix	163-165	3
β-strand	166-167	2	4
α-helix	172	1
β-strand	173-181	9	4
β-strand	189-195	7	5
β-strand	200-206	7	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Butyrophilin subfamily 3 member A1	A	protein	226	Homo sapiens	O00481 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4F80_1 Butyrophilin subfamily 3 member A1 (chains A)
ADLQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVE
DRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAAL
GSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAA
SVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQHHHHHH

Primary citation

The molecular basis for modulation of human V(gamma)9V(delta)2 T cell responses by CD277/Butyrophilin-3 (BTN3A)-specific antibodies. Palakodeti, A., Sandstrom, A., Sundaresan, L. et al. J Biol Chem (2012) 287:32780-32790. DOI 10.1074/jbc.M112.384354 · PubMed

Other PDB entries of the same protein (UniProt O00481 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ITA 1.2 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 mutant
6ISM 1.25 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 mutant
8IZE 1.4 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 in complex with 4-HMBPP
4N7I 1.4 Å, Crystal Structure of Intracellular B30.2 Domain of BTN3A1
4N7U 1.46 Å, Crystal Structure of Intracellular B30.2 Domain of BTN3A1 in Complex with CHDMAPP
5LYG 1.6 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 bound to malonate
8IZG 1.6 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 in complex with 5-HMBPP
5LYK 1.7 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 bound to citrate
8IXV 1.72 Å, Crystal structure of intracellular B30.2 domain of BTN3A in complex with 2Cl-HMBPP
4K55 1.91 Å, Structure of the extracellular domain of butyrophilin BTN3A1 in complex with…
5HM7 1.93 Å, The Intracellular domain of Butyrophilin 3A1 protein
5ZXK 1.96 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 in complex with HMBPP

Browse structure collections

About this viewer

MolViewer shows 4F80 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.