4F8A: PDB entry 4F8A

Cyclic nucleotide binding-homology domain from mouse EAG1 potassium channel. Determined by X-ray diffraction at 2.2 Å resolution. Released 11 Jul 2012.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,207
Mol. weight: 18.02 kDa
Released: 11 Jul 2012

Explore 4F8A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4F8A contains 7 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	564-571	8
α-helix	573-576	4
α-helix	580-582	3
α-helix	587-594	8
β-strand	598-602	5	1
β-strand	607-609	3	2
β-strand	614	1	3
β-strand	617-623	7	1
β-strand	625-630	6	2
β-strand	633-639	7	2
β-strand	643-645	3	1
β-strand	656	1	3
β-strand	660-663	4	2
β-strand	667-673	7	1
α-helix	674-683	10
α-helix	685-694	10
β-strand	699-700	2	1
α-helix	704-706	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Potassium voltage-gated channel subfamily H member 1	A	protein	160	Mus musculus	Q60603 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4F8A_1 Potassium voltage-gated channel subfamily H member 1 (chains A)
GSHMTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDL
IYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEATLAQSCANVRALTYC
DLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVF

Primary citation

Structural, Biochemical, and Functional Characterization of the Cyclic Nucleotide Binding Homology Domain from the Mouse EAG1 Potassium Channel. Marques-Carvalho, M.J., Sahoo, N., Muskett, F.W. et al. J Mol Biol (2012) 423:34-46. DOI 10.1016/j.jmb.2012.06.025 · PubMed

Other PDB entries of the same protein (UniProt Q60603 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HOI 1.85 Å, Crystal structure of PAS domain from the mouse EAG1 potassium channel
4LLO 2.0 Å, Structure of the eag domain-CNBHD complex of the mouse EAG1 channel
5HIT 2.85 Å, Crystal Structure Analysis of Ca2+-calmodulin and a C-terminal EAG1 channel fragment

Browse structure collections

About this viewer

MolViewer shows 4F8A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.