Crystal structure of porcine aminopeptidase-N complexed with bestatin. Determined by X-ray diffraction at 2.6 Å resolution. Released 17 Oct 2012.
Explore 4FKK in 3D Show helices and sheets RCSB PDB PDBe
4FKK contains 49 α-helices and 37 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 66-68 | 3 | |
| α-helix | 72-73 | 2 | |
| β-strand | 76-87 | 12 | 1 |
| β-strand | 98-109 | 12 | 1 |
| β-strand | 113-119 | 7 | 2 |
| β-strand | 123-125 | 3 | 1 |
| β-strand | 133-136 | 4 | 1 |
| α-helix | 143-144 | 2 | |
| β-strand | 145-151 | 7 | 2 |
| β-strand | 156-165 | 10 | 2 |
| β-strand | 170-180 | 11 | 1 |
| β-strand | 187-195 | 9 | 3 |
| β-strand | 198-206 | 9 | 3 |
| α-helix | 212-214 | 3 | |
| β-strand | 218 | 1 | 2 |
| β-strand | 226 | 1 | 4 |
| β-strand | 227-235 | 9 | 1 |
| β-strand | 239-242 | 4 | 3 |
| α-helix | 245 | 1 | |
| β-strand | 246 | 1 | 5 |
| β-strand | 251-252 | 2 | 1 |
| β-strand | 259-263 | 5 | 1 |
| β-strand | 264 | 1 | 5 |
| α-helix | 265-268 | 4 | |
| β-strand | 270 | 1 | 4 |
| α-helix | 272-274 | 3 | |
| β-strand | 277-280 | 4 | 3 |
| β-strand | 283-288 | 6 | 6 |
| β-strand | 294-299 | 6 | 6 |
| α-helix | 301-305 | 5 | |
| α-helix | 310-326 | 17 | |
| β-strand | 335-341 | 7 | 6 |
| β-strand | 348-349 | 2 | 6 |
| β-strand | 354-358 | 5 | 6 |
| α-helix | 359-362 | 4 | |
| α-helix | 371-387 | 17 | |
| β-strand | 390 | 1 | 7 |
| β-strand | 394-396 | 3 | 7 |
| α-helix | 399-401 | 3 | |
| α-helix | 402-420 | 19 | |
| α-helix | 426-429 | 4 | |
| α-helix | 430 | 1 | |
| α-helix | 431-435 | 5 | |
| α-helix | 436-442 | 7 | |
| α-helix | 454-456 | 3 | |
| α-helix | 460-464 | 5 | |
| α-helix | 469 | 1 | |
| α-helix | 470-474 | 5 | |
| α-helix | 475-486 | 12 | |
| α-helix | 488-502 | 15 | |
| β-strand | 505-507 | 3 | 7 |
| α-helix | 509-521 | 13 | |
| α-helix | 532-540 | 9 | |
| β-strand | 546-551 | 6 | 8 |
| β-strand | 556-561 | 6 | 8 |
| β-strand | 582-584 | 3 | 9 |
| β-strand | 586-588 | 3 | 10 |
| β-strand | 591-592 | 2 | 10 |
| β-strand | 596-598 | 3 | 9 |
| β-strand | 603-605 | 3 | 8 |
| α-helix | 607-609 | 3 | |
| β-strand | 617-619 | 3 | 10 |
| α-helix | 621-623 | 3 | |
| β-strand | 628-630 | 3 | 8 |
| α-helix | 633-645 | 13 | |
| α-helix | 647-649 | 3 | |
| α-helix | 652-667 | 16 | |
| α-helix | 673-678 | 6 | |
| α-helix | 681-685 | 5 | |
| α-helix | 689-706 | 18 | |
| α-helix | 712-733 | 22 | |
| α-helix | 744-759 | 16 | |
| α-helix | 763-777 | 15 | |
| α-helix | 787-789 | 3 | |
| α-helix | 790-800 | 11 | |
| α-helix | 803-815 | 13 | |
| α-helix | 819-828 | 10 | |
| α-helix | 829-831 | 3 | |
| α-helix | 835-845 | 11 | |
| α-helix | 853-865 | 13 | |
| α-helix | 869-880 | 12 | |
| α-helix | 895-902 | 8 | |
| α-helix | 909-919 | 11 | |
| α-helix | 920-922 | 3 | |
| α-helix | 928-930 | 3 | |
| α-helix | 933-962 | 30 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Aminopeptidase N | A | protein | 909 | Sus scrofa | P15145 (AlphaFold model) |
>4FKK_1 Aminopeptidase N (chains A) DQSKPWNRYRLPTTLLPDSYNVTLRPYLTPNADGLYIFKGKSIVRFLCQEPTDVIIIHSK KLNYTTQGHMVVLRGVGDSQVPEIDRTELVELTEYLVVHLKGSLQPGHMYEMESEFQGEL ADDLAGFYRSEYMEGNVKKVLATTQMQSTDARKSFPCFDEPAMKATFNITLIHPNNLTAL SNMPPKGSSTPLAEDPNWSVTEFETTPVMSTYLLAYIVSEFQSVNETAQNGVLIRIWARP NAIAEGHGMYALNVTGPILNFFANHYNTSYPLPKSDQIALPDFNAGAMENWGLVTYRENA LLFDPQSSSISNKERVVTVIAHELAHQWFGNLVTLAWWNDLWLNEGFASYVEYLGADHAE PTWNLKDLIVPGDVYRVMAVDALASSHPLTTPAEEVNTPAQISEMFDSISYSKGASVIRM LSNFLTEDLFKEGLASYLHAFAYQNTTYLDLWEHLQKAVDAQTSIRLPDTVRAIMDRWTL QMGFPVITVDTKTGNISQKHFLLDSESNVTRSSAFDYLWIVPISSIKNGVMQDHYWLRDV SQAQNDLFKTASDDWVLLNVNVTGYFQVNYDEDNWRMIQHQLQTNLSVIPVINRAQVIYD SFNLATAHMVPVTLALDNTLFLNGEKEYMPWQAALSSLSYFSLMFDRSEVYGPMKKYLRK QVEPLFQHFETLTKNWTERPENLMDQYSEINAISTACSNGLPQCENLAKTLFDQWMSDPE NNPIHPNLRSTIYCNAIAQGGQDQWDFAWGQLQQAQLVNEADKLRSALACSNEVWLLNRY LGYTLNPDLIRKQDATSTINSIASNVIGQPLAWDFVQSNWKKLFQDYGGGSFSFSNLIQG VTRRFSSEFELQQLEQFKKNNMDVGFGSGTRALEQALEKTKANIKWVKENKEVVLNWFIE HSSHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| BES | 2-(3-amino-2-hydroxy-4-phenyl-butyrylamino)-4-methyl-pentanoic acid | C16 H24 N2 O4 | 1 |
| ZN | Zinc ion | Zn | 1 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Structural basis for multifunctional roles of mammalian aminopeptidase N. Chen, L., Lin, Y.L., Peng, G. et al. Proc Natl Acad Sci U S A (2012) 109:17966-17971. DOI 10.1073/pnas.1210123109 · PubMed
Other PDB entries of the same protein (UniProt P15145 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4FKK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.