Crystal Structure of bovine hsc70(aa1-554)E213A/D214A at 1.9A Resolution. Determined by X-ray diffraction at 1.9 Å resolution. Released 2 Oct 2013.
Explore 4FL9 in 3D Show helices and sheets RCSB PDB PDBe
4FL9 contains 24 α-helices and 32 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-11 | 5 | 1 |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 25-28 | 4 | 1 |
| α-helix | 29-30 | 2 | |
| β-strand | 38-39 | 2 | 1 |
| β-strand | 41-44 | 4 | 2 |
| β-strand | 49-51 | 3 | 2 |
| α-helix | 53-57 | 5 | |
| α-helix | 63-65 | 3 | |
| β-strand | 66-68 | 3 | 2 |
| α-helix | 70-73 | 4 | |
| α-helix | 81-87 | 7 | |
| β-strand | 93-97 | 5 | 3 |
| β-strand | 100-107 | 8 | 3 |
| β-strand | 110-114 | 5 | 3 |
| α-helix | 116-135 | 20 | |
| β-strand | 141-146 | 6 | 1 |
| α-helix | 152-164 | 13 | |
| β-strand | 168-174 | 7 | 1 |
| α-helix | 175-182 | 8 | |
| β-strand | 193-200 | 8 | 4 |
| β-strand | 205-213 | 9 | 4 |
| β-strand | 216-225 | 10 | 4 |
| α-helix | 230-249 | 20 | |
| α-helix | 253-255 | 3 | |
| α-helix | 257-276 | 20 | |
| β-strand | 279-288 | 10 | 5 |
| β-strand | 291-298 | 8 | 5 |
| α-helix | 299-305 | 7 | |
| α-helix | 307-312 | 6 | |
| α-helix | 314-323 | 10 | |
| α-helix | 328-330 | 3 | |
| β-strand | 333-337 | 5 | 4 |
| α-helix | 339-342 | 4 | |
| α-helix | 344-353 | 10 | |
| α-helix | 357-359 | 3 | |
| β-strand | 360 | 1 | 4 |
| α-helix | 368-380 | 13 | |
| β-strand | 396 | 1 | 6 |
| β-strand | 401-405 | 5 | 7 |
| β-strand | 409-414 | 6 | 7 |
| β-strand | 419 | 1 | 6 |
| β-strand | 422-428 | 7 | 8 |
| β-strand | 429-430 | 2 | 9 |
| β-strand | 438-444 | 7 | 7 |
| β-strand | 449 | 1 | 7 |
| α-helix | 450-452 | 3 | |
| β-strand | 454-461 | 8 | 7 |
| α-helix | 464-466 | 3 | |
| β-strand | 474-480 | 7 | 8 |
| β-strand | 486-492 | 7 | 8 |
| β-strand | 498-503 | 6 | 8 |
| α-helix | 512-524 | 13 | |
| α-helix | 526-534 | 9 | |
| β-strand | 541-542 | 2 | 9 |
| α-helix | 547-549 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heat shock cognate 71 kDa protein | A | protein | 554 | Bos taurus | P19120 (AlphaFold model) |
>4FL9_1 Heat shock cognate 71 kDa protein (chains A) MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIAAGIFEVKSTAGDTHLGGEDFDNRMVNH FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN SLESYAFNMKATVE
Crystal Structure of bovine hsc70(aa1-554)E213A/D214A at 1.9A Resolution. Grimm, C. To be published.
Other PDB entries of the same protein (UniProt P19120 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4FL9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.