4FP9: Human MTERF4-NSUN4 protein complex
Human MTERF4-NSUN4 protein complex. Determined by X-ray diffraction at 2.9 Å resolution. Released 12 Sept 2012.
- Method
- X-ray diffraction
- Resolution
- 2.9 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 18,717
- Mol. weight
- 318.87 kDa
- Ligands
- SAM
- Released
- 12 Sept 2012
Explore 4FP9 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4FP9 contains 185 α-helices and 68 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 23 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 40-56 | 17 | |
| α-helix | 57-59 | 3 | |
| α-helix | 60-67 | 8 | |
| α-helix | 70-72 | 3 | |
| β-strand | 74-77 | 4 | 1 |
| α-helix | 79-81 | 3 | |
| α-helix | 83-91 | 9 | |
| β-strand | 96-97 | 2 | 1 |
| α-helix | 98-104 | 7 | |
| α-helix | 121-124 | 4 | |
| β-strand | 131-133 | 3 | 1 |
| α-helix | 134-135 | 2 | |
| α-helix | 142-145 | 4 | |
| β-strand | 147 | 1 | 2 |
| β-strand | 153 | 1 | 2 |
| β-strand | 155-158 | 4 | 1 |
| α-helix | 160-163 | 4 | |
| α-helix | 164-169 | 6 | |
| β-strand | 175-179 | 5 | 3 |
| α-helix | 186-193 | 8 | |
| β-strand | 197-203 | 7 | 3 |
| α-helix | 207-220 | 14 | |
| α-helix | 223-226 | 4 | |
| β-strand | 231-234 | 4 | 3 |
| α-helix | 238-242 | 5 | |
| β-strand | 249-255 | 7 | 3 |
| α-helix | 261-264 | 4 | |
| α-helix | 275-277 | 3 | |
| α-helix | 278-282 | 5 | |
| α-helix | 284-297 | 14 | |
| β-strand | 299-309 | 11 | 3 |
| α-helix | 318-331 | 14 | |
| β-strand | 336-338 | 3 | 3 |
| α-helix | 339-340 | 2 | |
| α-helix | 342-348 | 7 | |
| β-strand | 354 | 1 | 3 |
| β-strand | 362-364 | 3 | 3 |
| β-strand | 367 | 1 | 4 |
| β-strand | 370 | 1 | 4 |
| β-strand | 375-382 | 8 | 3 |
Chain B: 23 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 84-101 | 18 | |
| α-helix | 106-115 | 10 | |
| α-helix | 121-133 | 13 | |
| α-helix | 138-147 | 10 | |
| α-helix | 149-153 | 5 | |
| α-helix | 156-168 | 13 | |
| α-helix | 176-182 | 7 | |
| α-helix | 184-187 | 4 | |
| α-helix | 191-199 | 9 | |
| α-helix | 200-204 | 5 | |
| α-helix | 209-218 | 10 | |
| α-helix | 220-223 | 4 | |
| α-helix | 227-235 | 9 | |
| α-helix | 236-241 | 6 | |
| α-helix | 245-250 | 6 | |
| α-helix | 253-255 | 3 | |
| α-helix | 258-271 | 14 | |
| α-helix | 275-277 | 3 | |
| α-helix | 286-289 | 4 | |
| α-helix | 290-293 | 4 | |
| α-helix | 298-300 | 3 | |
| α-helix | 301-305 | 5 | |
| α-helix | 310-325 | 16 | |
Chain C: 23 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 40-56 | 17 | |
| α-helix | 57-59 | 3 | |
| α-helix | 60-67 | 8 | |
| α-helix | 70-72 | 3 | |
| β-strand | 74-77 | 4 | 5 |
| α-helix | 79-81 | 3 | |
| α-helix | 83-91 | 9 | |
| β-strand | 96-97 | 2 | 5 |
| α-helix | 98-104 | 7 | |
| α-helix | 121-124 | 4 | |
| β-strand | 131-133 | 3 | 5 |
| α-helix | 134-135 | 2 | |
| α-helix | 142-145 | 4 | |
| β-strand | 147 | 1 | 6 |
| β-strand | 153 | 1 | 6 |
| β-strand | 155-158 | 4 | 5 |
| α-helix | 160-163 | 4 | |
| α-helix | 164-169 | 6 | |
| β-strand | 175-179 | 5 | 7 |
| α-helix | 186-193 | 8 | |
| β-strand | 197-203 | 7 | 7 |
| α-helix | 207-220 | 14 | |
| α-helix | 223-226 | 4 | |
| β-strand | 231-234 | 4 | 7 |
| α-helix | 238-242 | 5 | |
| β-strand | 249-255 | 7 | 7 |
| α-helix | 263-265 | 3 | |
| α-helix | 275-277 | 3 | |
| α-helix | 278-282 | 5 | |
| α-helix | 284-298 | 15 | |
| β-strand | 299-309 | 11 | 7 |
| α-helix | 318-331 | 14 | |
| β-strand | 336-338 | 3 | 7 |
| α-helix | 339-340 | 2 | |
| α-helix | 342-348 | 7 | |
| β-strand | 354 | 1 | 7 |
| β-strand | 362-364 | 3 | 7 |
| β-strand | 367 | 1 | 8 |
| β-strand | 370 | 1 | 8 |
| β-strand | 375-382 | 8 | 7 |
Chain D: 22 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 40-56 | 17 | |
| α-helix | 57-59 | 3 | |
| α-helix | 60-67 | 8 | |
| α-helix | 70-72 | 3 | |
| β-strand | 74-77 | 4 | 9 |
| α-helix | 79-81 | 3 | |
| α-helix | 83-91 | 9 | |
| β-strand | 96-97 | 2 | 9 |
| α-helix | 98-104 | 7 | |
| β-strand | 131-133 | 3 | 9 |
| α-helix | 134-135 | 2 | |
| α-helix | 142-145 | 4 | |
| β-strand | 147 | 1 | 10 |
| β-strand | 153 | 1 | 10 |
| β-strand | 155-158 | 4 | 9 |
| α-helix | 160-163 | 4 | |
| α-helix | 164-169 | 6 | |
| β-strand | 175-179 | 5 | 11 |
| α-helix | 186-193 | 8 | |
| β-strand | 197-203 | 7 | 11 |
| α-helix | 207-220 | 14 | |
| α-helix | 223-226 | 4 | |
| β-strand | 231-234 | 4 | 11 |
| α-helix | 238-242 | 5 | |
| β-strand | 249-255 | 7 | 11 |
| α-helix | 261-264 | 4 | |
| α-helix | 275-277 | 3 | |
| α-helix | 278-282 | 5 | |
| α-helix | 284-298 | 15 | |
| β-strand | 299-309 | 11 | 11 |
| α-helix | 318-331 | 14 | |
| β-strand | 336-338 | 3 | 11 |
| α-helix | 339-340 | 2 | |
| α-helix | 342-348 | 7 | |
| β-strand | 354 | 1 | 11 |
| β-strand | 362-364 | 3 | 11 |
| β-strand | 367 | 1 | 12 |
| β-strand | 370 | 1 | 12 |
| β-strand | 375-382 | 8 | 11 |
Chain E: 24 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 84-101 | 18 | |
| α-helix | 106-115 | 10 | |
| α-helix | 121-133 | 13 | |
| α-helix | 138-147 | 10 | |
| α-helix | 149-153 | 5 | |
| α-helix | 156-166 | 11 | |
| α-helix | 167-171 | 5 | |
| α-helix | 176-182 | 7 | |
| α-helix | 184-187 | 4 | |
| α-helix | 191-199 | 9 | |
| α-helix | 200-204 | 5 | |
| α-helix | 209-218 | 10 | |
| α-helix | 220-223 | 4 | |
| α-helix | 227-235 | 9 | |
| α-helix | 236-241 | 6 | |
| α-helix | 245-250 | 6 | |
| α-helix | 253-255 | 3 | |
| α-helix | 258-271 | 14 | |
| α-helix | 275-277 | 3 | |
| α-helix | 286-289 | 4 | |
| α-helix | 290-293 | 4 | |
| α-helix | 298-300 | 3 | |
| α-helix | 301-305 | 5 | |
| α-helix | 310-325 | 16 | |
Chain F: 23 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 40-56 | 17 | |
| α-helix | 57-59 | 3 | |
| α-helix | 60-67 | 8 | |
| α-helix | 70-72 | 3 | |
| β-strand | 74-77 | 4 | 13 |
| α-helix | 79-81 | 3 | |
| α-helix | 83-91 | 9 | |
| β-strand | 96-97 | 2 | 13 |
| α-helix | 98-104 | 7 | |
| α-helix | 121-124 | 4 | |
| β-strand | 131-133 | 3 | 13 |
| α-helix | 134-135 | 2 | |
| α-helix | 142-145 | 4 | |
| β-strand | 147 | 1 | 14 |
| β-strand | 153 | 1 | 14 |
| β-strand | 155-158 | 4 | 13 |
| α-helix | 160-163 | 4 | |
| α-helix | 164-169 | 6 | |
| β-strand | 175-179 | 5 | 15 |
| α-helix | 186-193 | 8 | |
| β-strand | 197-203 | 7 | 15 |
| α-helix | 207-220 | 14 | |
| α-helix | 223-226 | 4 | |
| β-strand | 231-234 | 4 | 15 |
| α-helix | 238-242 | 5 | |
| β-strand | 249-255 | 7 | 15 |
| α-helix | 261-264 | 4 | |
| α-helix | 275-277 | 3 | |
| α-helix | 278-282 | 5 | |
| α-helix | 284-298 | 15 | |
| β-strand | 299-309 | 11 | 15 |
| α-helix | 318-331 | 14 | |
| β-strand | 336-338 | 3 | 15 |
| α-helix | 339-340 | 2 | |
| α-helix | 342-348 | 7 | |
| β-strand | 354 | 1 | 15 |
| β-strand | 362-364 | 3 | 15 |
| β-strand | 367 | 1 | 16 |
| β-strand | 370 | 1 | 16 |
| β-strand | 375-382 | 8 | 15 |
Chain G: 24 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 84-102 | 19 | |
| α-helix | 106-108 | 3 | |
| α-helix | 110-115 | 6 | |
| α-helix | 121-133 | 13 | |
| α-helix | 138-147 | 10 | |
| α-helix | 149-153 | 5 | |
| α-helix | 156-168 | 13 | |
| α-helix | 177-182 | 6 | |
| α-helix | 184-186 | 3 | |
| α-helix | 191-199 | 9 | |
| α-helix | 200-204 | 5 | |
| α-helix | 209-218 | 10 | |
| α-helix | 220-222 | 3 | |
| α-helix | 227-235 | 9 | |
| α-helix | 236-241 | 6 | |
| α-helix | 245-250 | 6 | |
| α-helix | 253-255 | 3 | |
| α-helix | 258-271 | 14 | |
| α-helix | 275-277 | 3 | |
| α-helix | 286-289 | 4 | |
| α-helix | 290-293 | 4 | |
| α-helix | 298-300 | 3 | |
| α-helix | 301-306 | 6 | |
| α-helix | 310-325 | 16 | |
Chain H: 23 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 84-97 | 14 | |
| α-helix | 106-115 | 10 | |
| α-helix | 121-133 | 13 | |
| α-helix | 138-147 | 10 | |
| α-helix | 149-152 | 4 | |
| α-helix | 156-166 | 11 | |
| α-helix | 167-171 | 5 | |
| α-helix | 176-182 | 7 | |
| α-helix | 184-187 | 4 | |
| α-helix | 191-199 | 9 | |
| α-helix | 200-204 | 5 | |
| α-helix | 209-218 | 10 | |
| α-helix | 220-223 | 4 | |
| α-helix | 227-235 | 9 | |
| α-helix | 236-241 | 6 | |
| α-helix | 245-250 | 6 | |
| α-helix | 253-255 | 3 | |
| α-helix | 258-271 | 14 | |
| α-helix | 286-289 | 4 | |
| α-helix | 290-293 | 4 | |
| α-helix | 298-300 | 3 | |
| α-helix | 301-305 | 5 | |
| α-helix | 310-325 | 16 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| methyltransferase NSUN4 | A, C, D, F | protein | 360 | Homo sapiens | Q96CB9 (AlphaFold model) |
| mTERF domain-containing protein 2 | B, E, G, H | protein | 335 | Homo sapiens | Q7Z6M4 (AlphaFold model) |
Sequence of entity 1 (A, C, D, F), FASTA
>4FP9_1 methyltransferase NSUN4 (chains A, C, D, F)
MRYKKKWAATEPKFPAVRLALQNFDMTYSVQFGDLWPSIRVSLLSEQKYGALVNNFAAWD
HVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSPASWACSPNLRCFTFDRGDISRFPP
ARPGSLGVMEYYLMDAASLLPVLALGLQPGDIVLDLCAAPGGKTLALLQTGCCRNLAAND
LSPSRIARLQKILHSYVPEEIRDGNQVRVTSWDGRKWGELEGDTYDRVLVDVPCTTDRHS
LHEEENNIFKRSRKKERQILPVLQVQLLAAGLLATKPGGHVVYSTCSLSHLQNEYVVQGA
IELLANQYSIQVQVEDLTHFRRVFMDTFCFFSSCQVGELVIPNLMANFGPMYFCKMRRLT
Sequence of entity 2 (B, E, G, H), FASTA
>4FP9_2 mTERF domain-containing protein 2 (chains B, E, G, H)
SNGGVIEELSCVRSNNYVQEPECRRNLVQCLLEKQGTPVVQGSLELERVMSSLLDMGFSN
AHINELLSVRRGASLQQLLDIISEFILLGLNPEPVCVVLKKSPQLLKLPIMQMRKRSSYL
QKLGLGEGKLKRVLYCCPEIFTMRQQDINDTVRLLKEKCLFTVQQVTKILHSCPSVLRED
LGQLEYKFQYAYFRMGIKHPDIVKSEYLQYSLTKIKQRHIYLERLGRYQTPDKKGQTQIP
NPLLKDILRVSEAEFLARTACTSVEEFQVFKKLLAREEEESESSTSDDKRASLDEDEDDD
DEEDNDEDDNDEDDDDEDDDEAEDNDEDEDDDEEE
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| SAM | S-adenosylmethionine | C15 H22 N6 O5 S | 4 |
Water and common crystallization additives (SO4) are not listed.
Primary citation
Structure of the human MTERF4-NSUN4 protein complex that regulates mitochondrial ribosome biogenesis. Spahr, H., Habermann, B., Gustafsson, C.M. et al. Proc Natl Acad Sci U S A (2012) 109:15253-15258. DOI 10.1073/pnas.1210688109 · PubMed
Other PDB entries of the same protein (UniProt Q96CB9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4FZV 2.0 Å, Crystal structure of the human MTERF4:NSUN4:SAM ternary complex
- 7OF0 2.2 Å, Structure of a human mitochondrial ribosome large subunit assembly intermediate in…
- 7OF7 2.5 Å, Structure of a human mitochondrial ribosome large subunit assembly intermediate in…
- 7O9M 2.6 Å, Human mitochondrial ribosome large subunit assembly intermediate with MTERF4-NSUN4,…
- 7OF3 2.7 Å, Structure of a human mitochondrial ribosome large subunit assembly intermediate in…
- 7ODR 2.9 Å, State A of the human mitoribosomal large subunit assembly intermediate
- 7OF5 2.9 Å, Structure of a human mitochondrial ribosome large subunit assembly intermediate in…
- 8QSJ 3.0 Å, Human mitoribosomal large subunit assembly intermediate 2 with GTPBP7
- 8PK0 3.03 Å, human mitoribosomal large subunit assembly intermediate 1 with GTPBP10-GTPBP7
- 7O9K 3.1 Å, Human mitochondrial ribosome large subunit assembly intermediate with MTERF4-NSUN4,…
- 7ODS 3.1 Å, State B of the human mitoribosomal large subunit assembly intermediate
- 7ODT 3.1 Å, State C of the human mitoribosomal large subunit assembly intermediate
Browse structure collections
About this viewer
MolViewer shows 4FP9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.