4FQN: CCM2 C-terminal Harmonin Homology Domain

Crystal structure of the CCM2 C-terminal Harmonin Homology Domain (HHD). Determined by X-ray diffraction at 1.9 Å resolution. Released 19 Dec 2012.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,270
Mol. weight: 44.65 kDa
Released: 19 Dec 2012

Explore 4FQN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4FQN contains 25 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	288-291	4
α-helix	293-306	14
α-helix	312-326	15
α-helix	331-342	12
α-helix	344-356	13
α-helix	359-371	13

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	288-291	4
α-helix	293-307	15
α-helix	312-327	16
α-helix	331-342	12
α-helix	344-356	13
α-helix	359-371	13

Chain C: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	294-304	11
α-helix	312-326	15
α-helix	331-342	12
α-helix	344-352	9
α-helix	354-356	3
α-helix	359-361	3
α-helix	362-371	10

Chain D: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	300-305	6
α-helix	306-308	3
α-helix	312-326	15
α-helix	331-342	12
α-helix	344-356	13
α-helix	359-371	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Malcavernin	A, B, C, D	protein	98	Homo sapiens	Q9BSQ5 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4FQN_1 Malcavernin (chains A, B, C, D)
GSKTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQL
YGDSRKFLLLGLRPFIPEKDSQHFENFLETIGVKDGRG

Primary citation

Structural studies of cerebral cavernous malformations 2 (CCM2) reveal a folded helical domain at its C-terminus. Fisher, O.S., Zhang, R., Li, X. et al. FEBS Lett (2013) 587:272-277. DOI 10.1016/j.febslet.2012.12.011 · PubMed

Other PDB entries of the same protein (UniProt Q9BSQ5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4YKD 1.93 Å, Crystal structure of truncated cerebral cavernous malformation 2 C-terminal adaptor domain
4YL6 2.1 Å, Crystal structure of truncated cerebral cavernous malformation 2 C-terminal adaptor…
4Y5O 2.35 Å, CCM2 HHD in complex with MEKK3 NPB1
4YKC 2.7 Å, Crystal structure of cerebral cavernous malformation 2 C-terminal adaptor domain
4WJ7 2.75 Å, CCM2 PTB domain in complex with KRIT1 NPxY/F3
4TVQ 2.8 Å, CCM3 in complex with CCM2 LD-like motif
9PVG 3.0 Å, Co-crystal structure of two CCM2 PTB domains bound to a KRIT1 peptide encompassing NPxF2…

Browse structure collections

About this viewer

MolViewer shows 4FQN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.