4YKD: Malcavernin

Crystal structure of truncated cerebral cavernous malformation 2 C-terminal adaptor domain. Determined by X-ray diffraction at 1.93 Å resolution. Released 3 Jun 2015.

Method: X-ray diffraction
Resolution: 1.93 Å
Organism: Homo sapiens
Chains: 1
Atoms: 762
Mol. weight: 11.3 kDa
Released: 3 Jun 2015

Explore 4YKD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4YKD contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	295-307	13
α-helix	312-326	15
α-helix	331-342	12
α-helix	344-356	13
α-helix	359-371	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Malcavernin	A	protein	96	Homo sapiens	Q9BSQ5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4YKD_1 Malcavernin (chains A)
MELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKF
LLLGLRPFIPEKDSQHFENFLETIGVKDLEHHHHHH

Primary citation

Structural Insights into the Molecular Recognition between Cerebral Cavernous Malformation 2 and Mitogen-Activated Protein Kinase Kinase Kinase 3. Wang, X., Hou, Y., Deng, K. et al. Structure (2015) 23:1087-1096. DOI 10.1016/j.str.2015.04.003 · PubMed

Other PDB entries of the same protein (UniProt Q9BSQ5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FQN 1.9 Å, Crystal structure of the CCM2 C-terminal Harmonin Homology Domain (HHD)
4YL6 2.1 Å, Crystal structure of truncated cerebral cavernous malformation 2 C-terminal adaptor…
4Y5O 2.35 Å, CCM2 HHD in complex with MEKK3 NPB1
4YKC 2.7 Å, Crystal structure of cerebral cavernous malformation 2 C-terminal adaptor domain
4WJ7 2.75 Å, CCM2 PTB domain in complex with KRIT1 NPxY/F3
4TVQ 2.8 Å, CCM3 in complex with CCM2 LD-like motif
9PVG 3.0 Å, Co-crystal structure of two CCM2 PTB domains bound to a KRIT1 peptide encompassing NPxF2…

Browse structure collections

About this viewer

MolViewer shows 4YKD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.