4FXW: Splicing factor U2AF 65 kDa subunit

Structure of phosphorylated SF1 complex with U2AF65-UHM domain. Determined by X-ray diffraction at 2.29 Å resolution. Released 16 Jan 2013.

Method: X-ray diffraction
Resolution: 2.29 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,409
Mol. weight: 54.04 kDa
Released: 16 Jan 2013

Explore 4FXW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4FXW contains 19 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	377-381	5	1
α-helix	386-389	4
α-helix	392-406	15
β-strand	414-416	3	1
β-strand	431-435	5	1
α-helix	439-449	11
β-strand	453-454	2	2
β-strand	457-458	2	2
β-strand	460-463	4	1
α-helix	466-470	5

Chain B: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	2
β-strand	39	1	1
α-helix	40-41	2
α-helix	46-67	22
α-helix	80-85	6
β-strand	87	1	3
β-strand	93	1	3
α-helix	97-115	19
α-helix	116-118	3

Chain C: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	377-381	5	4
α-helix	386-390	5
α-helix	392-406	15
β-strand	412-416	5	4
β-strand	431-436	6	4
α-helix	439-449	11
β-strand	453-454	2	5
β-strand	457-458	2	5
α-helix	459	1
β-strand	460-463	4	4
α-helix	466-470	5

Chain D: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	5
β-strand	39	1	4
α-helix	40-41	2
α-helix	46-63	18
α-helix	64-68	5
α-helix	80-85	6
β-strand	87	1	6
β-strand	93	1	6
α-helix	97-119	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Splicing factor U2AF 65 kDa subunit	A, C	protein	106	Homo sapiens	P26368 (AlphaFold model)
Splicing factor 1	B, D	protein	124	Homo sapiens	Q15637 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4FXW_1 Splicing factor U2AF 65 kDa subunit (chains A, C)
GPLGSTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGC
GKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW

Sequence of entity 2 (B, D), FASTA

>4FXW_2 Splicing factor 1 (chains B, D)
GPLGSSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTG
DLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPAD
YKPP

Primary citation

Structure of Phosphorylated SF1 Bound to U2AF(65) in an Essential Splicing Factor Complex. Wang, W., Maucuer, A., Gupta, A. et al. Structure (2013) 21:197-208. DOI 10.1016/j.str.2012.10.020 · PubMed

Other PDB entries of the same protein (UniProt P26368 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W0G 1.07 Å, Structure of U2AF65 (U2AF2) RRM1 at 1.07 resolution
5W0H 1.11 Å, Structure of U2AF65 (U2AF2) RRM2 at 1.11 Angstrom Resolution
6XLV 1.4 Å, Crystal structure of leukemia-associated N196K mutant of U2AF65 bound to AdML splice site
9C7A 1.4 Å, Crystal structure of R149W neurodevelopmental disease-associated U2AF2 variant
9C7B 1.4 Å, Crystal structure of R150H neurodevelopmental disease-associated U2AF2 variant
2HZC 1.47 Å, Crystal structure of the N-terminal RRM of the U2AF large subunit
7S3A 1.48 Å, Crystal structure of intact U2AF65 RRM-region bound to AdML-C5 oligonucleotide
5EV3 1.5 Å, Structure III of Intact U2AF65 Recognizing the 3' Splice Site Signal
6XLW 1.5 Å, Crystal structure of U2AF65 bound to AdML splice site sequence
7S3C 1.51 Å, Crystal structure of intact U2AF65 RRM-region bound to AdML-A5 oligonucleotide
5EV4 1.57 Å, Structure IV of Intact U2AF65 Recognizing the 3' Splice Site Signal
6XLX 1.7 Å, Crystal structure of cancer-associated G301D mutant of U2AF65 bound to AdML splice site

Browse structure collections

About this viewer

MolViewer shows 4FXW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.