4GB0: RING domain of RNF168

Crystal Structure of the RING domain of RNF168. Determined by X-ray diffraction at 2.6 Å resolution. Released 10 Jul 2013.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 743
Mol. weight: 14.15 kDa
Ligands: MLI, ZN
Released: 10 Jul 2013

Explore 4GB0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GB0 contains 6 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	12-14	3
β-strand	15	1	1
β-strand	22	1	1
β-strand	26-28	3	2
β-strand	34-36	3	2
α-helix	37-39	3
α-helix	40-48	9
β-strand	50	1	3
β-strand	57	1	3
α-helix	59-67	9
α-helix	74-83	10
α-helix	85-92	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase RNF168	A	protein	121	Homo sapiens	Q8IYW5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4GB0_1 E3 ubiquitin-protein ligase RNF168 (chains A)
MGHHHHHHGSMALPKDAIPSLSECQCGICMEILVEPVTLPCNHTLCKPCFQSTVEKASLC
CPFCRRRVSSWTRYHTRRNSLVNVELWTIIQKHYPRECKLRASGQESEEVADDYQPVRLL
S

Ligands and cofactors

ID	Name	Formula	Copies
MLI	Malonate ion	C3 H2 O4	1
ZN	Zinc ion	Zn	2

Primary citation

Structural basis for role of ring finger protein RNF168 RING domain. Zhang, X.Q., Chen, J., Wu, M. et al. Cell Cycle (2013) 12:312-321. DOI 10.4161/cc.23104 · PubMed

Other PDB entries of the same protein (UniProt Q8IYW5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5XIS 1.78 Å, Crystal structure of RNF168 UDM1 in complex with Lys63-linked diubiquitin, form I
5XIU 1.8 Å, Crystal structure of RNF168 UDM2 in complex with Lys63-linked diubiquitin
8UQA 2.05 Å, Crystal structure of RNF168 (RING)-UbcH5c fused to H2A-H2B via a 12-residue linker
3L11 2.12 Å, Crystal Structure of the Ring Domain of RNF168
5XIT 2.25 Å, Crystal structure of RNF168 UDM1 in complex with Lys63-linked diubiquitin, form II
8UQ9 2.3 Å, Crystal structure of RNF168 (RING)-UbcH5c fused to H2A-H2B via a 4-residue linker
8UQ8 2.34 Å, Crystal structure of RNF168 (RING)-UbcH5c fused to H2A-H2B via a 2-residue linker
8UQB 2.48 Å, Crystal structure of RNF168 (RING)-UbcH5c fused to H2A-H2B via a 20-residue linker…
5YDK 2.5 Å, Crystal structure of RNF168 UDM1 in complex with Lys63-linked diubiquitin, tetrameric form
8UQC 2.61 Å, Crystal structure of RNF168 (RING)-UbcH5c fused to H2A-H2B via a 20-residue linker…
8SMX 3.2 Å, Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and…
8SMY 3.2 Å, Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and…

Browse structure collections

About this viewer

MolViewer shows 4GB0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.