Crystal structure of RNF168 (RING)-UbcH5c fused to H2A-H2B via a 4-residue linker. Determined by X-ray diffraction at 2.3 Å resolution. Released 17 Jan 2024.
Explore 8UQ9 in 3D Show helices and sheets RCSB PDB PDBe
8UQ9 contains 50 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-7 | 3 | |
| α-helix | 8-10 | 3 | |
| α-helix | 12-14 | 3 | |
| β-strand | 15 | 1 | 8 |
| β-strand | 22 | 1 | 8 |
| α-helix | 23 | 1 | |
| β-strand | 27-28 | 2 | 9 |
| β-strand | 34-35 | 2 | 9 |
| α-helix | 37-40 | 4 | |
| α-helix | 41-48 | 8 | |
| β-strand | 50 | 1 | 10 |
| β-strand | 57 | 1 | 10 |
| α-helix | 59-67 | 9 | |
| β-strand | 72 | 1 | 9 |
| α-helix | 74-83 | 10 | |
| α-helix | 85-90 | 6 | |
| α-helix | 1002-1015 | 14 | |
| α-helix | 1017-1018 | 2 | |
| β-strand | 1021-1025 | 5 | 11 |
| β-strand | 1032-1038 | 7 | 11 |
| α-helix | 1039-1040 | 2 | |
| β-strand | 1049-1055 | 7 | 11 |
| β-strand | 1066-1069 | 4 | 11 |
| β-strand | 1075 | 1 | 12 |
| β-strand | 1078 | 1 | 12 |
| β-strand | 1083 | 1 | 11 |
| β-strand | 1084 | 1 | 12 |
| α-helix | 1087-1089 | 3 | |
| α-helix | 1099-1111 | 13 | |
| α-helix | 1121-1129 | 9 | |
| α-helix | 1131-1145 | 15 | |
| α-helix | 2038-2048 | 11 | |
| β-strand | 2053-2054 | 2 | 13 |
| α-helix | 2056-2083 | 28 | |
| β-strand | 2088-2089 | 2 | 14 |
| α-helix | 2091-2101 | 11 | |
| α-helix | 2104-2122 | 19 | |
| α-helix | 3017-3021 | 5 | |
| α-helix | 3027-3036 | 10 | |
| β-strand | 3042-3043 | 2 | 14 |
| α-helix | 3046-3072 | 27 | |
| β-strand | 3077-3078 | 2 | 13 |
| α-helix | 3080-3089 | 10 | |
| α-helix | 3091-3097 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-7 | 3 | |
| α-helix | 8-10 | 3 | |
| α-helix | 12-14 | 3 | |
| β-strand | 15 | 1 | 1 |
| β-strand | 22 | 1 | 1 |
| α-helix | 23 | 1 | |
| β-strand | 27-28 | 2 | 2 |
| β-strand | 34-35 | 2 | 2 |
| α-helix | 37-39 | 3 | |
| α-helix | 40-48 | 9 | |
| β-strand | 50 | 1 | 3 |
| β-strand | 57 | 1 | 3 |
| α-helix | 59-67 | 9 | |
| β-strand | 72 | 1 | 2 |
| α-helix | 74-83 | 10 | |
| α-helix | 85-90 | 6 | |
| α-helix | 1002-1015 | 14 | |
| β-strand | 1022-1025 | 4 | 4 |
| β-strand | 1032-1038 | 7 | 4 |
| α-helix | 1039-1040 | 2 | |
| β-strand | 1049-1055 | 7 | 4 |
| α-helix | 1064-1065 | 2 | |
| β-strand | 1066-1069 | 4 | 4 |
| β-strand | 1075 | 1 | 5 |
| β-strand | 1078 | 1 | 5 |
| β-strand | 1083 | 1 | 4 |
| β-strand | 1084 | 1 | 5 |
| α-helix | 1087-1089 | 3 | |
| α-helix | 1099-1111 | 13 | |
| α-helix | 1121-1129 | 9 | |
| α-helix | 1131-1145 | 15 | |
| α-helix | 2038-2048 | 11 | |
| β-strand | 2053-2054 | 2 | 6 |
| α-helix | 2056-2083 | 28 | |
| β-strand | 2088-2089 | 2 | 7 |
| α-helix | 2091-2101 | 11 | |
| α-helix | 2104-2122 | 19 | |
| α-helix | 3017-3021 | 5 | |
| α-helix | 3027-3036 | 10 | |
| β-strand | 3042-3043 | 2 | 7 |
| α-helix | 3046-3072 | 27 | |
| β-strand | 3077-3078 | 2 | 6 |
| α-helix | 3080-3089 | 10 | |
| α-helix | 3091-3097 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase RNF168,Ubiquitin-conjugating enzyme E2 D3,Histone H2B type 2-E,Histone… | A, a | protein | 439 | Homo sapiens | P04908 (AlphaFold model), P61077 (AlphaFold model), Q16778 (AlphaFold model), Q8IYW5 (AlphaFold model) |
>8UQ9_1 E3 ubiquitin-protein ligase RNF168,Ubiquitin-conjugating enzyme E2 D3,Histone H2B type 2-E,Histone H2A type 1-B/E (chains A, a) GHMALPKDAIPSLSECQCGICMEILVEPVTLPCNHTLCKPCFQSTVEKASLCCPFCRRRV SSWTRYHTRRNSLVNVELWTIIQKHYPRECKLRASGSGSGSGSALKRINKELSDLARDPP AQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNI NSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRIS REWTQKYAMGSGGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSAKAKTRSSRAGLQFP VGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLA IRNDEELNKLLGRVTIAQG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
Water and common crystallization additives (CL, GOL, NA) are not listed.
Mechanisms of RNF168 nucleosome recognition and ubiquitylation. Hu, Q., Zhao, D., Cui, G. et al. Mol Cell (2024) 84:839-853.e12. DOI 10.1016/j.molcel.2023.12.036 · PubMed
Other PDB entries of the same protein (UniProt P04908 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8UQ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.