4GBA: DCN1-like protein 3

DCNL complex with N-terminally acetylated NEDD8 E2 peptide. Determined by X-ray diffraction at 2.4 Å resolution. Released 28 Nov 2012.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,535
Mol. weight: 56.65 kDa
Released: 28 Nov 2012

Explore 4GBA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GBA contains 23 α-helices and 10 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	90-96	7
β-strand	105-106	2	1
α-helix	108-117	10
α-helix	125-133	9
β-strand	142-143	2	1
α-helix	144-154	11
α-helix	159-172	14
α-helix	176-190	15
β-strand	200-201	2	2
α-helix	202-212	11
α-helix	221-230	10
β-strand	237-238	2	2
α-helix	240-252	13
α-helix	268-282	15

Chain B: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	90-98	9
β-strand	105-106	2	3
α-helix	108-118	11
α-helix	125-133	9
β-strand	142-143	2	3
α-helix	144-153	10
α-helix	159-173	15
α-helix	176-190	15
β-strand	199-200	2	4
α-helix	202-212	11
α-helix	221-230	10
β-strand	238-239	2	4
α-helix	240-253	14
α-helix	257-259	3
α-helix	268-283	16
β-strand	288	1	5
β-strand	291	1	5

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5

Chain G: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DCN1-like protein 3	A, B	protein	221	Homo sapiens	Q8IWE4 (AlphaFold model)
NEDD8-conjugating enzyme UBE2F	F, G	protein	25	Homo sapiens	Q969M7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4GBA_1 DCN1-like protein 3 (chains A, B)
GSSSLQRLEELFRRYKDEREDAILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMCKFT
RKEFFDGCKAISADSIDGICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHRE
IAIALWKLVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSED
EAWPSLFDTFVEWEMERRKREGEGRGALSSGPEGLCPEEQT

Sequence of entity 2 (F, G), FASTA

>4GBA_2 NEDD8-conjugating enzyme UBE2F (chains F, G)
MLTLASKLKRDDGLKGSRTAATASD

Primary citation

Structural Conservation of Distinctive N-terminal Acetylation-Dependent Interactions across a Family of Mammalian NEDD8 Ligation Enzymes. Monda, J.K., Scott, D.C., Miller, D.J. et al. Structure (2013) 21:42-53. DOI 10.1016/j.str.2012.10.013 · PubMed

Browse structure collections

About this viewer

MolViewer shows 4GBA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.