4GFV: PTPN18

PTPN18 in complex with HER2-pY1196 phosphor-peptides. Determined by X-ray diffraction at 2.1 Å resolution. Released 23 Oct 2013.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,816
Mol. weight: 69.06 kDa
Released: 23 Oct 2013

Explore 4GFV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GFV contains 26 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	7-17	11
α-helix	20-22	3
α-helix	24-42	19
α-helix	49-52	4
α-helix	57-59	3
α-helix	69-71	3
β-strand	72	1	1
α-helix	79-81	3
β-strand	89-93	5	1
β-strand	99-104	6	1
α-helix	105-108	4
α-helix	112-121	10
β-strand	126-129	4	1
β-strand	134-135	2	2
β-strand	138-139	2	2
β-strand	147	1	3
β-strand	150	1	3
β-strand	152-154	3	1
β-strand	157-168	12	1
β-strand	171-180	10	1
β-strand	183-192	10	1
α-helix	205-218	14
α-helix	223-224	2
β-strand	225-228	4	1
α-helix	234-251	18
α-helix	260-270	11
α-helix	278-292	15

Chain B: 12 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	10-17	8
α-helix	22-43	22
α-helix	49-52	4
α-helix	57-59	3
α-helix	69-71	3
β-strand	72	1	4
α-helix	79-81	3
β-strand	89-93	5	4
β-strand	99-104	6	4
α-helix	112-121	10
β-strand	126-129	4	4
β-strand	134-135	2	5
β-strand	138-139	2	5
β-strand	147	1	6
β-strand	150	1	6
β-strand	152-154	3	4
β-strand	157-168	12	4
β-strand	171-180	10	4
β-strand	183-192	10	4
α-helix	204-218	15
α-helix	223-224	2
β-strand	225-228	4	4
α-helix	234-251	18
α-helix	260-268	9
α-helix	278-291	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 18	A, B	protein	297	Homo sapiens	Q99952 (AlphaFold model)
HER2-pY1196 phosphor-peptide	E, F	protein	6	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>4GFV_1 Tyrosine-protein phosphatase non-receptor type 18 (chains A, B)
AADSARSFLERLEARGGREGAVLAGEFSDIQACSAAWKADGVCSTVAGSRPENVRKNRYK
DVLPYDQTRVILSLLQEEGHSDYINGNFIRGVDGSLAYIATQGPLPHTLLDFWRLVWEFG
VKVILMACREIENGRKRCERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTFQKE
SRSVYQLQYMSWPDRGVPSSPDHMLAMVEEARRLQGSGPEPLCVHSSAGCGRTGVLCTVD
YVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMFCSTLQNAS

Sequence of entity 2 (E, F), FASTA

>4GFV_2 HER2-pY1196 phosphor-peptide (chains E, F)
PEYLTP

Primary citation

PTPN18-HER2 peptides. Wang, H.M., Yang, F., Du, Y.J. et al. To be published.

Other PDB entries of the same protein (UniProt Q99952 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OC3 1.5 Å, Crystal Structure of the Catalytic Domain of Human Protein Tyrosine Phosphatase…
4GFU 2.0 Å, PTPN18 in complex with HER2-pY1248 phosphor-peptides
4NND 2.5 Å, Structural basis of PTPN18 fingerprint on distinct HER2 tyrosine phosphorylation sites

Browse structure collections

About this viewer

MolViewer shows 4GFV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.