4GMQ: Ribosome-binding domain of Zuo1

Ribosome-binding domain of Zuo1. Determined by X-ray diffraction at 1.3 Å resolution. Released 5 Dec 2012.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Chaetomium thermophilum var. thermophilum DSM 1495
Chains: 1
Atoms: 876
Mol. weight: 11.06 kDa
Released: 5 Dec 2012

Explore 4GMQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GMQ contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	356-370	15
α-helix	372-374	3
α-helix	379-380	2
α-helix	381-397	17
α-helix	400-410	11
α-helix	416-432	17
α-helix	438-440	3
α-helix	443-445	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Putative ribosome associated protein	A	protein	103	Chaetomium thermophilum var. thermophilum DSM 1495	G0RYD6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4GMQ_1 Putative ribosome associated protein (chains A)
MGHHHHHHAAKNAVKKNKRVLRGSVKEANYFVEGEASAATIDAVLNDVDLVITKIDADEI
AALAGKLNGLTVADEIKNVWKEEVSRLVGAGKLKEGDIKALVA

Primary citation

Structural characterization of a eukaryotic chaperone-the ribosome-associated complex. Leidig, C., Bange, G., Kopp, J. et al. Nat Struct Mol Biol (2013) 20:23-28. DOI 10.1038/nsmb.2447 · PubMed

Other PDB entries of the same protein (UniProt G0RYD6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SR6 2.5 Å, Crystal structure of the RAC core with a pseudo substrate bound to Ssz1 SBD
5MB9 3.2 Å, Crystal structure of the eukaryotic ribosome associated complex (RAC), a unique…
7Z3N 3.2 Å, Cryo-EM structure of the ribosome-associated RAC complex on the 80S ribosome - RAC-1…
7Z3O 3.3 Å, Cryo-EM structure of the ribosome-associated RAC complex on the 80S ribosome - RAC-2…

Browse structure collections

About this viewer

MolViewer shows 4GMQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.