5MB9: Putative heat shock protein

Crystal structure of the eukaryotic ribosome associated complex (RAC), a unique Hsp70/Hsp40 pair. Determined by X-ray diffraction at 3.2 Å resolution. Released 28 Dec 2016.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719), Chaetomium thermophilum
Chains: 4
Atoms: 8,185
Mol. weight: 138.96 kDa
Ligands: ATP, MG
Released: 28 Dec 2016

Explore 5MB9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5MB9 contains 48 α-helices and 63 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	15-20	6	1
β-strand	24-30	7	1
β-strand	35-38	4	1
α-helix	39	1
β-strand	47-48	2	1
β-strand	50-54	5	2
β-strand	57-60	4	2
α-helix	62-66	5
β-strand	75-77	3	2
α-helix	80-82	3
α-helix	94-96	3
α-helix	99-100	2
β-strand	101-104	4	3
β-strand	107-112	6	3
α-helix	121-122	2
β-strand	123-126	4	3
α-helix	127-146	20
β-strand	152-157	6	1
α-helix	163-175	13
β-strand	179-185	7	1
α-helix	186-195	10
β-strand	205-212	8	4
β-strand	217-225	9	4
β-strand	228-237	10	4
α-helix	242-260	19
α-helix	265-266	2
α-helix	267-269	3
α-helix	271-290	20
β-strand	293-302	10	5
β-strand	305-312	8	5
α-helix	313-319	7
α-helix	321-337	17
α-helix	342-344	3
β-strand	347-351	5	4
α-helix	353-356	4
α-helix	358-367	10
β-strand	373-375	3	4
α-helix	389-401	13
α-helix	406-419	14
β-strand	421-423	3	6
β-strand	426-429	4	7
β-strand	430	1	8
β-strand	440	1	8
β-strand	444	1	7
α-helix	448	1
β-strand	449	1	6
β-strand	453-456	4	9
β-strand	467-480	14	7
β-strand	523-538	16	7
β-strand	549-553	5	9
β-strand	558-563	6	9

Chain B: 23 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	15-20	6	10
β-strand	24-31	8	10
β-strand	34-38	5	10
α-helix	39	1
β-strand	47-48	2	10
β-strand	50-54	5	11
β-strand	57-60	4	11
α-helix	61-66	6
β-strand	75-77	3	11
α-helix	80-82	3
α-helix	87-89	3
α-helix	94-96	3
α-helix	99-101	3
β-strand	102-104	3	12
β-strand	107-112	6	12
α-helix	121-122	2
β-strand	123-126	4	12
α-helix	127-146	20
β-strand	152-157	6	10
α-helix	163-175	13
β-strand	179-185	7	10
α-helix	186-195	10
β-strand	205-212	8	13
β-strand	217-225	9	13
β-strand	228-237	10	13
α-helix	242-260	19
α-helix	267-269	3
α-helix	271-290	20
β-strand	293-302	10	14
β-strand	305-312	8	14
α-helix	313-319	7
α-helix	321-337	17
α-helix	342-344	3
β-strand	347-351	5	13
α-helix	353-356	4
α-helix	358-367	10
β-strand	373-375	3	13
α-helix	389-401	13
α-helix	406-411	6
α-helix	412-416	5
α-helix	417-419	3
β-strand	421-423	3	15
β-strand	426-429	4	16
β-strand	441-444	4	16
α-helix	448	1
β-strand	449	1	15
β-strand	453-456	4	17
β-strand	471-478	8	16
β-strand	525-532	8	16
β-strand	547-553	7	17
β-strand	559-565	7	17

Chain C: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	31-33	3
β-strand	34-36	3	15
β-strand	39-40	2	13
α-helix	44-56	13

Chain D: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	24-28	5	9
α-helix	31-33	3
β-strand	34-36	3	6
β-strand	39	1	4
α-helix	44-55	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Putative heat shock protein	A, B	protein	590	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZX9 (AlphaFold model)
Putative ribosome associated protein	C, D	protein	45	Chaetomium thermophilum	G0RYD6 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5MB9_1 Putative heat shock protein (chains A, B)
SAMGWSHPQFEKMAESASKAAPGERVVIGITFGNSNSSIAHTVDDKAEVIANEDGDRQIP
TILSYVDGDEYYGQQAKNFLVRNPKNTVAYFRDILGQDFKSVDPTHNHASAHPQEAGDNV
VFTIKDKAEEDAEPSTLTVSEIATRYLRRLVGAASEYLGKKVTSAVITIPTNFTEKQKAA
LIAAAAAADLEVLQLISEPAAAVLAYDARPEATISDKIIVVADLGGSRSDVTVLASRSGM
YTILATVHDYEYHGIALDKVLIDHFSKEFLKKNPGAKDPRENPRSLAKLRLEAESTKRAL
SRSTNASFSVESLIDGLDFASTINRLRYETIARTVFEGFNRLVESAVKKAGLDPLDVDEV
IMSGGTSNTPRIAANFRYIFPESTRILAPSTDPSALNPSELQARGAALQASLIQEFETED
IEQSTHAAVTTMPHVTNAIGVVSVSESGEEKFVPIIAPETAVPARRTVHLDAPKEGGDVL
VKVVEGSTHINVIKPEPKAKEDGETKEKTEDADDDGDFDDDDEEEEEEEEEEEKREKVWK
IGSTLAEAAVRGVKKGAKVEVTINVNTDLTVIVTAREVGGKGGVRGTLSA

Sequence of entity 2 (C, D), FASTA

>5MB9_2 Putative ribosome associated protein (chains C, D)
GAMAEKDFKAIGKLTQEGSSMRTLEPVGPHFLAHARRVRHKRTFS

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2
MG	Magnesium ion	Mg	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structural insights into a unique Hsp70-Hsp40 interaction in the eukaryotic ribosome-associated complex. Weyer, F.A., Gumiero, A., Gese, G.V. et al. Nat Struct Mol Biol (2017) 24:144-151. DOI 10.1038/nsmb.3349 · PubMed

Other PDB entries of the same protein (UniProt G0RZX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GNI 1.8 Å, Structure of the Ssz1 ATPase bound to ATP and Magnesium
6SR6 2.5 Å, Crystal structure of the RAC core with a pseudo substrate bound to Ssz1 SBD
7Z3N 3.2 Å, Cryo-EM structure of the ribosome-associated RAC complex on the 80S ribosome - RAC-1…
7Z3O 3.3 Å, Cryo-EM structure of the ribosome-associated RAC complex on the 80S ribosome - RAC-2…

Browse structure collections

About this viewer

MolViewer shows 5MB9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.