4GNI: Ssz1 ATPase

Name: PDB 4GNI: Structure of the Ssz1 ATPase bound to ATP and Magnesium
Published: 2012-12-05
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Structure of the Ssz1 ATPase bound to ATP and Magnesium. Determined by X-ray diffraction at 1.8 Å resolution. Released 5 Dec 2012.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Chaetomium thermophilum var. thermophilum DSM 1495
Chains: 2
Atoms: 6,783
Mol. weight: 89.97 kDa
Ligands: MG, ATP
Released: 5 Dec 2012

Explore 4GNI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GNI contains 41 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	15-20	6	1
β-strand	24-31	8	1
β-strand	34-38	5	1
α-helix	39	1
β-strand	47-48	2	1
β-strand	50-54	5	2
β-strand	57-60	4	2
α-helix	61-70	10
α-helix	72-74	3
β-strand	75-77	3	2
α-helix	80-82	3
α-helix	87-89	3
α-helix	93-95	3
α-helix	99-101	3
β-strand	102-104	3	3
β-strand	107-112	6	3
α-helix	120-122	3
β-strand	123-126	4	3
α-helix	127-146	20
β-strand	152-157	6	1
α-helix	163-175	13
β-strand	179-185	7	1
α-helix	186-193	8
β-strand	205-212	8	4
β-strand	217-225	9	4
β-strand	228-237	10	4
α-helix	242-260	19
α-helix	264-266	3
α-helix	267-269	3
α-helix	271-290	20
β-strand	293-302	10	5
β-strand	305-312	8	5
α-helix	313-319	7
α-helix	321-337	17
α-helix	342-344	3
β-strand	347-351	5	4
α-helix	353-356	4
α-helix	358-367	10
β-strand	373-375	3	4
α-helix	389-402	14

Chain B: 20 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	15-20	6	6
β-strand	24-31	8	6
β-strand	34-38	5	6
α-helix	39	1
β-strand	47-48	2	6
β-strand	51-54	4	7
β-strand	57-60	4	7
α-helix	61-65	5
α-helix	72-74	3
β-strand	75-76	2	7
α-helix	80-82	3
α-helix	87-89	3
α-helix	93-95	3
α-helix	99-101	3
β-strand	102-104	3	8
β-strand	107-112	6	8
α-helix	121-122	2
β-strand	123-126	4	8
α-helix	127-146	20
β-strand	152-157	6	6
α-helix	163-175	13
β-strand	179-185	7	6
α-helix	186-194	9
β-strand	205-212	8	9
β-strand	217-225	9	9
β-strand	228-237	10	9
α-helix	242-260	19
α-helix	264-266	3
α-helix	267-269	3
α-helix	271-287	17
β-strand	293-302	10	10
β-strand	305-312	8	10
α-helix	313-337	25
α-helix	342-344	3
β-strand	347-351	5	9
α-helix	353-356	4
α-helix	358-367	10
β-strand	373-375	3	9
α-helix	389-401	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Putative heat shock protein	A, B	protein	409	Chaetomium thermophilum var. thermophilum DSM 1495	G0RZX9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4GNI_1 Putative heat shock protein (chains A, B)
MAESASKAAPGERVVIGITFGNSNSSIAHTVDDKAEVIANEDGDRQIPTILSYVDGDEYY
GQQAKNFLVRNPKNTVAYFRDILGQDFKSVDPTHNHASAHPQEAGDNVVFTIKDKAEEDA
EPSTLTVSEIATRYLRRLVGAASEYLGKKVTSAVITIPTNFTEKQKAALIAAAAAADLEV
LQLISEPAAAVLAYDARPEATISDKIIVVADLGGSRSDVTVLASRSGMYTILATVHDYEY
HGIALDKVLIDHFSKEFLKKNPGAKDPRENPRSLAKLRLEAESTKRALSRSTNASFSVES
LIDGLDFASTINRLRYETIARTVFEGFNRLVESAVKKAGLDPLDVDEVIMSGGTSNTPRI
AANFRYIFPESTRILAPSTDPSALNPSELQARGAALQASLIQEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2

Primary citation

Structural characterization of a eukaryotic chaperone-the ribosome-associated complex. Leidig, C., Bange, G., Kopp, J. et al. Nat Struct Mol Biol (2013) 20:23-28. DOI 10.1038/nsmb.2447 · PubMed

Other PDB entries of the same protein (UniProt G0RZX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SR6 2.5 Å, Crystal structure of the RAC core with a pseudo substrate bound to Ssz1 SBD
5MB9 3.2 Å, Crystal structure of the eukaryotic ribosome associated complex (RAC), a unique…
7Z3N 3.2 Å, Cryo-EM structure of the ribosome-associated RAC complex on the 80S ribosome - RAC-1…
7Z3O 3.3 Å, Cryo-EM structure of the ribosome-associated RAC complex on the 80S ribosome - RAC-2…

Browse structure collections

About this viewer

MolViewer shows 4GNI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.