4H3P: Human ERK2

Crystal structure of human ERK2 complexed with a MAPK docking peptide. Determined by X-ray diffraction at 2.3 Å resolution. Released 27 Feb 2013.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,926
Mol. weight: 89.23 kDa
Ligands: ANP
Released: 27 Feb 2013

Explore 4H3P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4H3P contains 45 α-helices and 26 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-14	3	1
β-strand	17-19	3	1
β-strand	25-33	9	2
β-strand	37-44	8	2
β-strand	49-56	8	2
α-helix	62-77	16
β-strand	83	1	3
β-strand	88-90	3	2
β-strand	101-106	6	2
β-strand	110-111	2	3
α-helix	112-116	5
α-helix	120-122	3
α-helix	123-142	20
β-strand	145-146	2	4
α-helix	152-154	3
β-strand	155-157	3	3
β-strand	163-165	3	3
β-strand	172-173	2	4
α-helix	196-198	3
α-helix	208-223	16
α-helix	233-244	12
α-helix	247-248	2
α-helix	261-265	5
α-helix	268-269	2
α-helix	284-293	10
α-helix	298-300	3
α-helix	302-303	2
α-helix	304-308	5
α-helix	311-313	3
α-helix	319-321	3
α-helix	340-351	12
α-helix	352-354	3

Chains B and E: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	717-719	3
α-helix	721-724	4

Chain D: 22 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-14	3	5
β-strand	17-19	3	5
β-strand	25-33	9	6
β-strand	37-44	8	6
β-strand	49-56	8	6
α-helix	62-77	16
β-strand	83	1	7
β-strand	88-90	3	6
β-strand	101-106	6	6
α-helix	107-108	2
β-strand	110-111	2	7
α-helix	112-115	4
α-helix	120-122	3
α-helix	123-142	20
β-strand	145-146	2	8
α-helix	152-154	3
β-strand	155-157	3	7
β-strand	163-165	3	7
β-strand	172-173	2	8
α-helix	191-193	3
α-helix	196-200	5
α-helix	208-223	16
α-helix	233-244	12
α-helix	247-248	2
α-helix	262-266	5
α-helix	268-269	2
α-helix	271-274	4
α-helix	284-293	10
α-helix	298-300	3
α-helix	302-303	2
α-helix	304-308	5
α-helix	311-313	3
α-helix	319-321	3
α-helix	340-350	11
α-helix	352-354	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitogen-activated protein kinase 1	A, D	protein	362	Homo sapiens	P28482 (AlphaFold model)
Ribosomal protein S6 kinase alpha-1	B, E	protein	24	Homo sapiens	Q15418 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>4H3P_1 Mitogen-activated protein kinase 1 (chains A, D)
GSMAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISP
FEHQTYCQRTLREIKILLAFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKT
QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDH
DHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLN
HILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNP
HKRIEVEQALAHPYLAQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
RS

Sequence of entity 2 (B, E), FASTA

>4H3P_2 Ribosomal protein S6 kinase alpha-1 (chains B, E)
PQLKPIEASILAARRVRKLPSTTL

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	2

Primary citation

Protein-peptide complex crystallization: a case study on the ERK2 mitogen-activated protein kinase. Gogl, G., Toeroe, I., Remenyi, A. Acta Crystallogr D Biol Crystallogr (2013) 69:486-489. DOI 10.1107/S0907444912051062 · PubMed

Other PDB entries of the same protein (UniProt P28482 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AOJ 1.12 Å, Specific covalent inhibitor of ERK2
4ZZN 1.33 Å, Human ERK2 in complex with an inhibitor
6SLG 1.33 Å, Human ERK2 with ERK1/2 inhibitor, AZD0364.
5WP1 1.4 Å, Complex of ERK2 with 5,7-dihydroxychromone
4QTA 1.45 Å, Structure of human ERK2 in complex with SCH772984 revealing a novel inhibitor-induced…
4QTE 1.5 Å, Structure of ERK2 in complex with VTX-11e, 4-{2-[(2-CHLORO-4-FLUOROPHENYL)AMINO]-5-METHYL…
2Y9Q 1.55 Å, Crystal structure of human ERK2 complexed with a MAPK docking peptide
6QA3 1.57 Å, ERK2 mini-fragment binding
6QAL 1.57 Å, ERK2 mini-fragment binding
6GJD 1.58 Å, Erk2 signalling protein
6QA1 1.58 Å, ERK2 mini-fragment binding
6QAH 1.58 Å, ERK2 mini-fragment binding

Browse structure collections

About this viewer

MolViewer shows 4H3P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.