Crystal Structure of the Guanine Nucleotide Exchange Factor Sec12 (P1 form). Determined by X-ray diffraction at 1.36 Å resolution. Released 7 Nov 2012.
Explore 4H5I in 3D Show helices and sheets RCSB PDB PDBe
4H5I contains 8 α-helices and 56 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-9 | 5 | 1 |
| β-strand | 14-21 | 8 | 2 |
| β-strand | 24-30 | 7 | 2 |
| β-strand | 40-47 | 8 | 2 |
| α-helix | 54-57 | 4 | |
| β-strand | 58-65 | 8 | 2 |
| α-helix | 71-73 | 3 | |
| β-strand | 75-79 | 5 | 3 |
| β-strand | 82-86 | 5 | 3 |
| α-helix | 91-96 | 6 | |
| β-strand | 103-109 | 7 | 3 |
| β-strand | 114-121 | 8 | 3 |
| β-strand | 133-138 | 6 | 4 |
| β-strand | 145-149 | 5 | 4 |
| β-strand | 155-160 | 6 | 4 |
| β-strand | 165-171 | 7 | 4 |
| β-strand | 178-181 | 4 | 5 |
| β-strand | 187-191 | 5 | 5 |
| β-strand | 196-200 | 5 | 5 |
| β-strand | 206-210 | 5 | 5 |
| β-strand | 217-226 | 10 | 6 |
| β-strand | 229-236 | 8 | 6 |
| β-strand | 242-250 | 9 | 6 |
| β-strand | 253-263 | 11 | 6 |
| β-strand | 269-274 | 6 | 7 |
| β-strand | 280-285 | 6 | 7 |
| β-strand | 290-294 | 5 | 7 |
| β-strand | 299-304 | 6 | 7 |
| β-strand | 312-317 | 6 | 1 |
| β-strand | 323-328 | 6 | 1 |
| β-strand | 332-337 | 6 | 1 |
| α-helix | 338-339 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Guanine nucleotide-exchange factor SEC12 | A, B | protein | 365 | Saccharomyces cerevisiae | P11655 (AlphaFold model) |
>4H5I_1 Guanine nucleotide-exchange factor SEC12 (chains A, B) MASMKFVTASYNVGYPAYGAKFLNNDTLLVAGGGGEGNNGIPNKLTVLRVDPTKDTEKEQ FHILSEFALEDNDDSPTAIDASKGIILVGCNENSTKITQGKGNKHLRKFKYDKVNDQLEF LTSVDFDASTNADDYTKLVYISREGTVAAIASSKVPAIMRIIDPSDLTEKFEIETRGEVK DLHFSTDGKVVAYITGSSLEVISTVTGSCIARKTDFDKNWSLSKINFIADDTVLIAASLK KGKGIVLTKISIKSGNTSVLRSKQVTNRFKGITSMDVDMKGELAVLASNDNSIALVKLKD LSMSKIFKQAHSFAITEVTISPDSTYVASVSAANTIHIIKLPLNYANYTSMKQKISKLEH HHHHH
The structure of sec12 implicates potassium ion coordination in sar1 activation. McMahon, C., Studer, S.M., Clendinen, C. et al. J Biol Chem (2012) 287:43599-43606. DOI 10.1074/jbc.M112.420141 · PubMed
Other PDB entries of the same protein (UniProt P11655 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4H5I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.