4HG7: MDM2/Nutlin-3a complex

Crystal Structure of an MDM2/Nutlin-3a complex. Determined by X-ray diffraction at 1.6 Å resolution. Released 31 Jul 2013.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 932
Mol. weight: 11.76 kDa
Ligands: NUT
Released: 31 Jul 2013

Explore 4HG7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HG7 contains 5 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	21-24	4
β-strand	27-28	2	1
β-strand	30	1	2
α-helix	32-40	9
β-strand	48-49	2	1
α-helix	50-63	14
β-strand	74-76	3	3
α-helix	81-86	6
β-strand	90-92	3	3
α-helix	96-104	9
β-strand	107	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase Mdm2	A	protein	97	Homo sapiens	Q00987 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4HG7_1 E3 ubiquitin-protein ligase Mdm2 (chains A)
GPLGSSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDAAQ
QHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLV

Ligands and cofactors

ID	Name	Formula	Copies
NUT	4-({(4S,5R)-4,5-bis(4-chlorophenyl)-2-[4-methoxy-2-(propan-2-yloxy)phenyl]-4,5-…	C30 H30 Cl2 N4 O4	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

The structure of an MDM2-Nutlin-3a complex solved by the use of a validated MDM2 surface-entropy reduction mutant. Anil, B., Riedinger, C., Endicott, J.A. et al. Acta Crystallogr D Biol Crystallogr (2013) 69:1358-1366. DOI 10.1107/S0907444913004459 · PubMed

Other PDB entries of the same protein (UniProt Q00987 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Q9L 1.13 Å, HDM2 (17-111, WILDTYPE) COMPLEXED WITH COMPOUND 9 AT 1.13A; Structural states of Hdm2…
5C5A 1.15 Å, Crystal Structure of HDM2 in complex with Nutlin-3a
6Q9O 1.21 Å, HDM2 (17-111, WILDTYPE) COMPLEXED WITH COMPOUND 10 AT 1.21A; Structural states of Hdm2…
5ZXF 1.25 Å, The 1.25A Crystal structure of His6-tagged Mdm2 in complex with nutlin-3a
7QDQ 1.26 Å, Crystal Structure of HDM2 in complex with Caylin-1
8F10 1.28 Å, Structure of the MDM2 P53 binding domain in complex with H102, an all-D Helicon…
8P0D 1.31 Å, Human 14-3-3 sigma in complex with human MDM2 peptide
5Z02 1.35 Å, Crystal structure of HIS6-tagged Mdm2 with nutlin-3a
8J81 1.35 Å, MDM2 bound with a peptoid
4OGN 1.38 Å, Co-Crystal Structure of MDM2 with Inhbitor Compound 3
2AXI 1.4 Å, HDM2 in complex with a beta-hairpin
7KJM 1.4 Å, Crystal structure of human MDM2 in complex with D-peptide inhibitor (dpmi-omega)

Browse more

4HG7 is part of these collections:

Kinases and cancer drug targets

About this viewer

MolViewer shows 4HG7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.