4HK0: UCA Fab (unbound) from CH65-CH67 Lineage

UCA Fab (unbound) from CH65-CH67 Lineage. Determined by X-ray diffraction at 2.5 Å resolution. Released 21 Nov 2012.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,548
Mol. weight: 96.81 kDa
Released: 21 Nov 2012

Explore 4HK0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HK0 contains 35 α-helices and 94 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
α-helix	7-9	3
β-strand	10-12	3	2
β-strand	18-25	8	1
β-strand	34-39	6	2
β-strand	46-51	6	2
β-strand	58-60	3	2
β-strand	65	1	1
β-strand	68-73	6	1
α-helix	74-76	3
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-98	7	2
β-strand	115-116	2	2
β-strand	120-124	5	2
α-helix	127-129	3
β-strand	130	1	3
α-helix	131-132	2
β-strand	133-137	5	4
β-strand	148-158	11	4
β-strand	159	1	3
β-strand	164-167	4	5
α-helix	168-170	3
β-strand	172	1	5
β-strand	176-178	3	4
α-helix	179-181	3
β-strand	182-183	2	4
β-strand	189-198	10	4
β-strand	208-213	6	5
α-helix	214-216	3
β-strand	218-223	6	5

Chain B: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	6
β-strand	9-12	4	7
β-strand	18-23	6	6
α-helix	27-29	3
β-strand	33-37	5	7
β-strand	44-47	4	7
β-strand	48	1	8
β-strand	52	1	8
α-helix	53-54	2
β-strand	61-66	6	6
β-strand	69-74	6	6
α-helix	79-81	3
β-strand	83-91	9	7
β-strand	96-99	4	7
β-strand	103-107	5	7
α-helix	110-112	3
β-strand	113	1	9
α-helix	114-115	2
β-strand	116-120	5	10
α-helix	121-123	3
α-helix	124-128	5
β-strand	133-141	9	10
β-strand	142	1	9
β-strand	147-152	6	11
β-strand	155-157	3	11
β-strand	161-163	3	10
α-helix	164-166	3
β-strand	167-168	2	10
β-strand	174-181	8	10
α-helix	184-188	5
β-strand	193-199	7	11
β-strand	202-208	7	11

Chain C: 9 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	12
α-helix	7-9	3
β-strand	10-12	3	13
β-strand	18-25	8	12
α-helix	29-31	3
β-strand	32-39	8	13
β-strand	46-51	6	13
β-strand	58-60	3	13
β-strand	65	1	12
β-strand	68-73	6	12
α-helix	74-76	3
β-strand	78-83	6	12
α-helix	88-90	3
β-strand	92-101	10	13
β-strand	115-116	2	13
β-strand	120-124	5	13
α-helix	128-129	2
β-strand	130	1	14
α-helix	131-132	2
β-strand	133-137	5	15
β-strand	148-158	11	15
β-strand	159	1	14
β-strand	164-167	4	16
α-helix	168-170	3
β-strand	172	1	16
β-strand	176-178	3	15
α-helix	179-181	3
β-strand	182-183	2	15
β-strand	189-198	10	15
β-strand	202	1	17
β-strand	205	1	17
β-strand	208-213	6	16
α-helix	214-216	3
β-strand	218-223	6	16

Chain D: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	18
β-strand	9-12	4	19
β-strand	18-23	6	18
α-helix	27-29	3
β-strand	33-37	5	19
β-strand	44-47	4	19
β-strand	48	1	20
β-strand	52	1	20
α-helix	53-54	2
β-strand	61-66	6	18
β-strand	69-74	6	18
α-helix	79-81	3
β-strand	83-91	9	19
β-strand	96-99	4	19
β-strand	103-107	5	19
α-helix	110-112	3
β-strand	113	1	21
α-helix	114-115	2
β-strand	116-120	5	22
α-helix	121-123	3
α-helix	124-128	5
β-strand	133-141	9	22
β-strand	142	1	21
β-strand	147-152	6	23
β-strand	155-157	3	23
β-strand	161-163	3	22
α-helix	164-166	3
β-strand	167-168	2	22
β-strand	174-181	8	22
α-helix	184-189	6
β-strand	193-199	7	23
β-strand	202-208	7	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
UCA heavy chain	A, C	protein	237	Homo sapiens
UCA light chain	B, D	protein	214	Homo sapiens	Q8N355 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4HK0_1 UCA heavy chain (chains A, C)
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNY
AQKFQGWVTMTRDTSISTAYMELSRLRSDDTAVYYCARGGLEPRSVDYYYYGMDVWGQGT
TVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP
AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKHHHHHH

Sequence of entity 2 (B, D), FASTA

>4HK0_2 UCA light chain (chains B, D)
QSVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPER
FSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHVVFGGGTKLTVLGQPKAAPSVTLF
PPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYL
SLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Primary citation

Preconfiguration of the antigen-binding site during affinity maturation of a broadly neutralizing influenza virus antibody. Schmidt, A.G., Xu, H., Khan, A.R. et al. Proc Natl Acad Sci U S A (2013) 110:264-269. DOI 10.1073/pnas.1218256109 · PubMed

Other PDB entries of the same protein (UniProt Q8N355 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2DD8 2.3 Å, Crystal Structure of SARS-CoV Spike Receptor-Binding Domain Complexed with Neutralizing…
6VPY 2.36 Å, I33M (I3.2 mutant from CH103 Lineage)
4FQQ 2.42 Å, Crystal Structure of Germline Antibody PGT121-GL Fab
6UDJ 2.5 Å, HIV-1 bNAb 1-18 in complex with BG505 SOSIP.664 and 10-1074
5UGY 2.8 Å, Influenza hemagglutinin in complex with a neutralizing antibody
4HK3 3.0 Å, I2 Fab (unbound) from CH65-CH67 Lineage
6DC3 3.5 Å, RSV prefusion F bound to RSD5 Fab
6UDK 3.9 Å, HIV-1 bNAb 1-55 in complex with modified BG505 SOSIP-based immunogen RC1 and 10-1074
6C5V 4.8 Å, An anti-gH/gL antibody that neutralizes dual-tropic infection defines a site of…

Browse structure collections

About this viewer

MolViewer shows 4HK0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.