Crystal structure of PAS domain from the mouse EAG1 potassium channel. Determined by X-ray diffraction at 1.85 Å resolution. Released 27 Mar 2013.
Explore 4HOI in 3D Show helices and sheets RCSB PDB PDBe
4HOI contains 17 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 30-34 | 5 | 1 |
| β-strand | 41 | 1 | 2 |
| β-strand | 42-45 | 4 | 1 |
| α-helix | 47-53 | 7 | |
| α-helix | 57-60 | 4 | |
| β-strand | 64 | 1 | 2 |
| α-helix | 68-70 | 3 | |
| α-helix | 77-88 | 12 | |
| β-strand | 93-100 | 8 | 1 |
| β-strand | 106-117 | 12 | 1 |
| β-strand | 123-132 | 10 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 30-34 | 5 | 5 |
| β-strand | 41 | 1 | 6 |
| β-strand | 42-45 | 4 | 5 |
| α-helix | 47-53 | 7 | |
| α-helix | 57-60 | 4 | |
| β-strand | 64 | 1 | 6 |
| α-helix | 68-70 | 3 | |
| α-helix | 77-88 | 12 | |
| β-strand | 93-100 | 8 | 5 |
| β-strand | 106-117 | 12 | 5 |
| β-strand | 123-132 | 10 | 5 |
| α-helix | 134-136 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 30-34 | 5 | 7 |
| β-strand | 41 | 1 | 8 |
| β-strand | 42-45 | 4 | 7 |
| α-helix | 47-53 | 7 | |
| α-helix | 57-60 | 4 | |
| β-strand | 64 | 1 | 8 |
| α-helix | 68-70 | 3 | |
| α-helix | 77-88 | 12 | |
| β-strand | 93-100 | 8 | 7 |
| β-strand | 106-117 | 12 | 7 |
| β-strand | 123-131 | 9 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Potassium voltage-gated channel subfamily H member 1 | A, B, C, D | protein | 114 | Mus musculus | Q60603 (AlphaFold model) |
>4HOI_1 Potassium voltage-gated channel subfamily H member 1 (chains A, B, C, D) GSHMTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSACSFMYGELTDKDTVEKV RQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFK
Structural properties of PAS domains from the KCNH potassium channels. Adaixo, R., Harley, C.A., Castro-Rodrigues, A.F. et al. PLoS One (2013) 8:e59265-e59265. DOI 10.1371/journal.pone.0059265 · PubMed
Other PDB entries of the same protein (UniProt Q60603 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4HOI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.