4HOI: PAS domain from the mouse EAG1 potassium channel

Crystal structure of PAS domain from the mouse EAG1 potassium channel. Determined by X-ray diffraction at 1.85 Å resolution. Released 27 Mar 2013.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Mus musculus
Chains: 4
Atoms: 4,210
Mol. weight: 53.79 kDa
Released: 27 Mar 2013

Explore 4HOI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HOI contains 17 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	30-34	5	1
β-strand	41	1	2
β-strand	42-45	4	1
α-helix	47-53	7
α-helix	57-60	4
β-strand	64	1	2
α-helix	68-70	3
α-helix	77-88	12
β-strand	93-100	8	1
β-strand	106-117	12	1
β-strand	123-132	10	1

Chain C: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	30-34	5	5
β-strand	41	1	6
β-strand	42-45	4	5
α-helix	47-53	7
α-helix	57-60	4
β-strand	64	1	6
α-helix	68-70	3
α-helix	77-88	12
β-strand	93-100	8	5
β-strand	106-117	12	5
β-strand	123-132	10	5
α-helix	134-136	3

Chain D: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	30-34	5	7
β-strand	41	1	8
β-strand	42-45	4	7
α-helix	47-53	7
α-helix	57-60	4
β-strand	64	1	8
α-helix	68-70	3
α-helix	77-88	12
β-strand	93-100	8	7
β-strand	106-117	12	7
β-strand	123-131	9	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Potassium voltage-gated channel subfamily H member 1	A, B, C, D	protein	114	Mus musculus	Q60603 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4HOI_1 Potassium voltage-gated channel subfamily H member 1 (chains A, B, C, D)
GSHMTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSACSFMYGELTDKDTVEKV
RQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFK

Primary citation

Structural properties of PAS domains from the KCNH potassium channels. Adaixo, R., Harley, C.A., Castro-Rodrigues, A.F. et al. PLoS One (2013) 8:e59265-e59265. DOI 10.1371/journal.pone.0059265 · PubMed

Other PDB entries of the same protein (UniProt Q60603 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LLO 2.0 Å, Structure of the eag domain-CNBHD complex of the mouse EAG1 channel
4F8A 2.2 Å, Cyclic nucleotide binding-homology domain from mouse EAG1 potassium channel
5HIT 2.85 Å, Crystal Structure Analysis of Ca2+-calmodulin and a C-terminal EAG1 channel fragment

Browse structure collections

About this viewer

MolViewer shows 4HOI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.