4HRL: Receptor tyrosine-protein kinase erbB-2

Structural Basis for Eliciting a Cytotoxic Effect in HER2-Overexpressing Cancer Cells via Binding to the Extracellular Domain of HER2. Determined by X-ray diffraction at 2.55 Å resolution. Released 16 Oct 2013.

Method: X-ray diffraction
Resolution: 2.55 Å
Organisms: Homo sapiens, synthetic
Chains: 2
Atoms: 2,559
Mol. weight: 40.77 kDa
Released: 16 Oct 2013

Explore 4HRL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HRL contains 17 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	10-24	15
α-helix	27-35	9
α-helix	50-57	8
α-helix	60-68	9
α-helix	82-89	8
α-helix	92-100	9
α-helix	115-121	7
α-helix	125-133	9
α-helix	148-154	7
α-helix	158-167	10

Chain C: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	1
α-helix	20-28	9
β-strand	33-34	2	1
β-strand	38-41	4	2
α-helix	50-52	3
β-strand	57-58	2	1
β-strand	62-65	4	2
β-strand	79-80	2	1
β-strand	86	1	2
β-strand	90-95	6	2
β-strand	117	1	3
β-strand	125-126	2	1
β-strand	130-134	5	2
β-strand	140	1	3
α-helix	142-144	3
α-helix	147-150	4
β-strand	151	1	1
α-helix	153-155	3
β-strand	160-162	3	2
α-helix	171-174	4
β-strand	182	1	4
α-helix	187-189	3
β-strand	190	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor tyrosine-protein kinase erbB-2	C	protein	198	Homo sapiens	P04626 (AlphaFold model)
Designed Ankyrin Repeat Protein 9_29	A	protein	171	synthetic

Sequence of entity 1 (C), FASTA

>4HRL_1 Receptor tyrosine-protein kinase erbB-2 (chains C)
HQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTDASLSFLQDIQEVQG
YVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLDNTTPVTGASPGGLRELQL
RSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTDRSRACHPCSPMCKGS
RCWGESSEDCQSLTRTVA

Sequence of entity 2 (A), FASTA

>4HRL_2 Designed Ankyrin Repeat Protein 9_29 (chains A)
MRGSHHHHHHGSDLGKKLLEAARAGQDDEVRILMANGADVNAHDFYGITPLHLAANFGHL
EIVEVLLKHGADVNAFDYDNTPLHLAADAGHLEIVEVLLKYGADVNASDRDGHTPLHLAA
REGHLEIVEVLLKNGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAAKLN

Primary citation

Structural Basis for Eliciting a Cytotoxic Effect in HER2-Overexpressing Cancer Cells via Binding to the Extracellular Domain of HER2. Jost, C., Schilling, J., Tamaskovic, R. et al. Structure (2013) 21:1-13. DOI 10.1016/j.str.2013.08.020 · PubMed

Other PDB entries of the same protein (UniProt P04626 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MFG 1.25 Å, The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
8VB5 1.48 Å, Crystal structure of kinase domain of HER2 Exon 20 insertion mutant in complex with…
8JYR 1.69 Å, Crystal structure of anti-HER2 antibody H2Mab-119 in complex with HER2 domain I
8U8X 1.69 Å, crystal structure of the receptor tyrosine kinase Human HER2 (ERBB2) YVMA mutant kinase…
8JYQ 1.75 Å, Crystal structure of cancer-specific anti-HER2 antibody H2Mab-214 in complex with…
7PCD 1.77 Å, HER2 in complex with a covalent inhibitor
5TQS 1.88 Å, Phospholipase C gamma-1 C-terminal SH2 domain bound to a phosphopeptide derived from the…
1MFL 1.88 Å, The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
4GFU 2.0 Å, PTPN18 in complex with HER2-pY1248 phosphor-peptides
6LBX 2.03 Å, Crystal structure of HER2 Domain IV and Rb-H2
9IUT 2.09 Å, Crystal structure of cancer-specific anti-HER2 antibody H2Mab-250 in complex with…
5MY6 2.25 Å, Crystal structure of a HER2-Nb complex

Browse structure collections

About this viewer

MolViewer shows 4HRL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.