4HS2: Human SPOP C-terminal Domain

Crystal Structure of the Human SPOP C-terminal Domain. Determined by X-ray diffraction at 1.53 Å resolution. Released 11 Sept 2013.

Method: X-ray diffraction
Resolution: 1.53 Å
Organism: Homo sapiens
Chains: 1
Atoms: 604
Mol. weight: 11.94 kDa
Released: 11 Sept 2013

Explore 4HS2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HS2 contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	302-311	10
α-helix	315-327	13
α-helix	329-332	4
α-helix	336-344	9
α-helix	346-358	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Speckle-type POZ protein	A	protein	110	Homo sapiens	O43791 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4HS2_1 Speckle-type POZ protein (chains A)
GPLGSADDDLAAADKYADERKKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDF
INYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS

Primary citation

Structural basis of high-order oligomerization of the cullin-3 adaptor SPOP. van Geersdaele, L.K., Stead, M.A., Harrison, C.M. et al. Acta Crystallogr D Biol Crystallogr (2013) 69:1677-1684. DOI 10.1107/S0907444913012687 · PubMed

Other PDB entries of the same protein (UniProt O43791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IVV 1.25 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
7LIN 1.44 Å, X-ray structure of SPOP MATH domain (D140G) in complex with a 53BP1 peptide
7D3D 1.45 Å, Crystal structure of SPOP bound with a peptide
9HFV 1.45 Å, MyD88 peptide_2 bound to SPOP MATH domain
7LIP 1.48 Å, X-ray structure of SPOP MATH domain (D140G)
3HQL 1.66 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
3HQM 1.74 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
3IVB 1.75 Å, Structures of SPOP-Substrate Complexes: Insights into Architectures of BTB-Cul3…
6I5P 1.81 Å, Co-crystal structure of human SPOP MATH domain (E47K) and human BRD3 fragment
6I68 1.85 Å, Co-crystal structure of human SPOP MATH domain (M117V) and human BRD3 fragment
6I41 1.9 Å, Co-crystal structure of human SPOP MATH domain (wild-type) and human BRD3 fragment
9HGG 1.9 Å, SETD2 peptide bound to SPOP MATH domain

Browse structure collections

About this viewer

MolViewer shows 4HS2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.