MyD88 peptide_2 bound to SPOP MATH domain. Determined by X-ray diffraction at 1.45 Å resolution. Released 18 Jun 2025.
Explore 9HFV in 3D Show helices and sheets RCSB PDB PDBe
9HFV contains 6 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-38 | 11 | 1 |
| α-helix | 41-43 | 3 | |
| β-strand | 52-53 | 2 | 2 |
| α-helix | 54-56 | 3 | |
| β-strand | 57 | 1 | 2 |
| β-strand | 66-72 | 7 | 2 |
| α-helix | 78-80 | 3 | |
| β-strand | 83-92 | 10 | 2 |
| β-strand | 98-107 | 10 | 1 |
| β-strand | 113-118 | 6 | 1 |
| β-strand | 123-125 | 3 | 1 |
| β-strand | 130-138 | 9 | 2 |
| α-helix | 139-142 | 4 | |
| α-helix | 145-147 | 3 | |
| α-helix | 151-153 | 3 | |
| β-strand | 155-165 | 11 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Speckle-type POZ protein | A | protein | 141 | Homo sapiens | O43791 (AlphaFold model) |
| Myeloid differentiation primary response protein MyD88 | B | protein | 20 | Homo sapiens | Q99836 (AlphaFold model) |
>9HFV_1 Speckle-type POZ protein (chains A) APKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLS LYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDE ANGLLPDDKLTLFCEVSVVQD
>9HFV_2 Myeloid differentiation primary response protein MyD88 (chains B) KPLQVAAVDSSVPRTAELAG
Sequence rules for a long SPOP-binding degron required for protein ubiquitylation. Makhlouf, L., Mishra, M., Makhlouf, H. et al. Biochem J (2025) 482:583-600. DOI 10.1042/BCJ20253041 · PubMed
Other PDB entries of the same protein (UniProt O43791 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9HFV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.