4HW5: Human C3a anaphylatoxin

Crystal Structure of the Human C3a anaphylatoxin. Determined by X-ray diffraction at 2.25 Å resolution. Released 12 Dec 2012.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,306
Mol. weight: 19.19 kDa
Released: 12 Dec 2012

Explore 4HW5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HW5 contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	675-684	10
α-helix	688-690	3
α-helix	691-697	7
α-helix	707-711	5
α-helix	718-743	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C3	A, B	protein	83	Homo sapiens	P01024 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4HW5_1 Complement C3 (chains A, B)
GAGAAGSVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFL
DCCNYITELRRQHARASHLGLAR

Primary citation

Human C3a and C3a desArg anaphylatoxins have conserved structures, in contrast to C5a and C5a desArg. Bajic, G., Yatime, L., Klos, A. et al. Protein Sci (2013) 22:204-212. DOI 10.1002/pro.2200 · PubMed

Other PDB entries of the same protein (UniProt P01024 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WY7 1.7 Å, Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement…
2WY8 1.7 Å, Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement…
7UE9 1.75 Å, Structure of anti-C3d Fab(3d8b) in complex with C3d
1C3D 1.8 Å, X-ray crystal structure of C3D: a C3 fragment and ligand for complement receptor 2
6RMT 2.0 Å, Crystal structure of disulphide-linked human C3d dimer
7BAG 2.0 Å, C3b in complex with CP40
1GHQ 2.04 Å, CR2-C3D complex structure
3D5R 2.1 Å, Crystal Structure of Efb-C (N138A) / C3d Complex
3OXU 2.1 Å, Complement components factor H CCP19-20 and C3d in complex
4I6O 2.14 Å, Crystal structure of chemically synthesized human anaphylatoxin C3a
4ONT 2.15 Å, Ternary host recognition complex of complement factor H, C3d, and sialic acid
2GOX 2.2 Å, Crystal structure of Efb-C / C3d Complex

Browse structure collections

About this viewer

MolViewer shows 4HW5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.