4I6O: Chemically synthesized human anaphylatoxin C3a

Crystal structure of chemically synthesized human anaphylatoxin C3a. Determined by X-ray diffraction at 2.14 Å resolution. Released 27 Feb 2013.

Method: X-ray diffraction
Resolution: 2.14 Å
Organism: Homo sapiens
Chains: 1
Atoms: 584
Mol. weight: 9.23 kDa
Released: 27 Feb 2013

Explore 4I6O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4I6O contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	17-26	10
α-helix	36-39	4
α-helix	47-72	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C3	A	protein	77	Homo sapiens	P01024 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4I6O_1 Complement C3 (chains A)
SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYI
TELRRQHARASHLGLAR

Primary citation

Efficient chemical synthesis of human complement protein C3a. Ghassemian, A., Wang, C.I., Yau, M.K. et al. Chem Commun (Camb) (2013) 49:2356-2358. DOI 10.1039/c3cc40537k · PubMed

Other PDB entries of the same protein (UniProt P01024 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WY7 1.7 Å, Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement…
2WY8 1.7 Å, Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement…
7UE9 1.75 Å, Structure of anti-C3d Fab(3d8b) in complex with C3d
1C3D 1.8 Å, X-ray crystal structure of C3D: a C3 fragment and ligand for complement receptor 2
6RMT 2.0 Å, Crystal structure of disulphide-linked human C3d dimer
7BAG 2.0 Å, C3b in complex with CP40
1GHQ 2.04 Å, CR2-C3D complex structure
3D5R 2.1 Å, Crystal Structure of Efb-C (N138A) / C3d Complex
3OXU 2.1 Å, Complement components factor H CCP19-20 and C3d in complex
4ONT 2.15 Å, Ternary host recognition complex of complement factor H, C3d, and sialic acid
2GOX 2.2 Å, Crystal structure of Efb-C / C3d Complex
4ZH1 2.24 Å, Complement factor H in complex with the GM1 glycan

Browse structure collections

About this viewer

MolViewer shows 4I6O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.