4I79: Human NUP43

Crystal structure of human NUP43. Determined by X-ray diffraction at 1.75 Å resolution. Released 27 Feb 2013.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 3
Atoms: 5,444
Mol. weight: 89.24 kDa
Released: 27 Feb 2013

Explore 4I79 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4I79 contains 6 α-helices and 60 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	1
β-strand	12-18	7	2
α-helix	19-22	4
α-helix	28-29	2
β-strand	31-37	7	2
β-strand	42-48	7	2
β-strand	66-73	8	2
β-strand	77-82	6	3
β-strand	87-92	6	3
β-strand	97-102	6	3
β-strand	109-115	7	3
β-strand	120	1	4
β-strand	131	1	4
β-strand	134-140	7	5
β-strand	143-148	6	5
β-strand	152-157	6	5
β-strand	165-168	4	5
β-strand	175-180	6	6
β-strand	185-190	6	6
β-strand	194-199	6	6
β-strand	209-212	4	6
β-strand	220-225	6	7
β-strand	232-237	6	7
β-strand	242-246	5	7
β-strand	255-257	3	7
β-strand	264-269	6	8
β-strand	276-281	6	8
β-strand	286-290	5	8
β-strand	341-344	4	8
β-strand	353-359	7	1
β-strand	362-367	6	1
β-strand	371-375	5	1

Chain B: 4 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	9
β-strand	13-18	6	10
α-helix	19-22	4
α-helix	28-29	2
β-strand	31-36	6	10
β-strand	42-49	8	10
β-strand	65-73	9	10
β-strand	77-82	6	11
β-strand	87-92	6	11
β-strand	97-103	7	11
β-strand	108-115	8	11
β-strand	120	1	12
β-strand	131	1	12
β-strand	134-140	7	13
β-strand	143-148	6	13
β-strand	153-157	5	13
β-strand	165-167	3	13
α-helix	174	1
β-strand	175-180	6	14
β-strand	185-190	6	14
β-strand	194-199	6	14
β-strand	209-212	4	14
β-strand	220-225	6	15
β-strand	232-237	6	15
β-strand	242-246	5	15
β-strand	255-257	3	15
β-strand	264-269	6	16
β-strand	276-281	6	16
β-strand	286-290	5	16
β-strand	341-344	4	16
α-helix	347	1
β-strand	353-359	7	9
β-strand	362-367	6	9
β-strand	371-375	5	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoporin Nup43	A, B	protein	399	Homo sapiens	Q8NFH3 (AlphaFold model)
floating chain, unknown sequence	C	protein	9	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>4I79_1 Nucleoporin Nup43 (chains A, B)
MGSSHHHHHHSSGLVPRGSMEEIYAKFVSQKISKTRWRPLPPGSLQTAETFATGSWDNEE
NYISLWSIGDFGNLDSDGGFEGDHQLLCDIRHHGDVMDLQFFDQERIVAASSTGCVTVFL
HHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCNNPEIVTVGEDGRINLFRADHK
EAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLH
CVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAHEAEMWEVHFHPSNPEHLFTCS
EDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIE
ITSLLPSRSLSVNTLDVLGPCLVCGTDAEAIYVTRHLFS

Sequence of entity 2 (C), FASTA

>4I79_2 floating chain, unknown sequence (chains C)
XXXXXXXXX

Primary citation

Crystal structure of human nuclear pore complex component NUP43. Xu, C., Li, Z., He, H. et al. FEBS Lett (2015) 589:3247-3253. DOI 10.1016/j.febslet.2015.09.008 · PubMed

Other PDB entries of the same protein (UniProt Q8NFH3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7R5K 12.0 Å, Human nuclear pore complex (constricted)
5A9Q 23.0 Å, Human nuclear pore complex
7PEQ 35.0 Å, Model of the outer rings of the human nuclear pore complex
7R5J 50.0 Å, Human nuclear pore complex (dilated)
9A25 Molecular assembly pathway of the human Nuclear Pore Complex after cell division
9A8T Integrative spatiotemporal modeling of biomolecular processes: application to the…

Browse structure collections

About this viewer

MolViewer shows 4I79 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.