4ID4: Chimeric beta-lactamase cTEM-17m

Crystal structure of chimeric beta-lactamase cTEM-17m. Determined by X-ray diffraction at 1.05 Å resolution. Released 25 Dec 2013.

Method: X-ray diffraction
Resolution: 1.05 Å
Organisms: Escherichia coli, Pseudomonas aeruginosa
Chains: 1
Atoms: 2,691
Mol. weight: 29.08 kDa
Ligands: MG
Released: 25 Dec 2013

Explore 4ID4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ID4 contains 13 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	27-40	14
β-strand	43-50	8	1
β-strand	56-60	5	1
β-strand	66-67	2	2
α-helix	69-71	3
α-helix	72-85	14
β-strand	94-95	2	3
α-helix	99-101	3
α-helix	109-111	3
β-strand	117-118	2	3
α-helix	119-128	10
α-helix	132-142	11
α-helix	145-154	10
α-helix	168-170	3
β-strand	180-181	2	2
α-helix	183-194	12
α-helix	201-212	12
α-helix	225-226	2
β-strand	230-237	8	1
β-strand	244-251	8	1
β-strand	259-266	8	1
α-helix	272-288	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-lactamase TEM, Beta-lactamase PSE-4	A	protein	263	Escherichia coli, Pseudomonas aeruginosa	P16897 (AlphaFold model), P62593 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4ID4_1 Beta-lactamase TEM, Beta-lactamase PSE-4 (chains A)
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVD
AGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGP
KELTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLRKLLTGELLTLASRQ
QLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTG
SQATMDERNRQIAEIGASLIKHW

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Maintenance of Native-like Protein Dynamics May Not Be Required for Engineering Functional Proteins. Gobeil, S.M., Clouthier, C.M., Park, J. et al. Chem Biol (2014) 21:1330-1340. DOI 10.1016/j.chembiol.2014.07.016 · PubMed

Other PDB entries of the same protein (UniProt P16897 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4R4S 1.1 Å, Crystal structure of chimeric beta-lactamase cTEM-19m at 1.1 angstrom resolution
4QY6 1.15 Å, Crystal structures of chimeric beta-lactamase cTEM-19m showing different conformations
4R4R 1.2 Å, Crystal structure of chimeric beta-lactamase cTEM-19m at 1.2 angstrom resolution
4QY5 1.5 Å, Crystal structures of chimeric beta-lactamase cTEM-19m showing different conformations
1G6A 1.75 Å, Pse-4 carbenicillinase, R234K mutant
1G68 1.95 Å, Pse-4 carbenicillinase, wild type
8J6Y 2.4 Å, Crystal structure of class A beta-lactamase PSE-4 WT- Apo state

Browse structure collections

About this viewer

MolViewer shows 4ID4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.